KEGG   Paenibacillus psychroresistens: EHS13_03765
Entry
EHS13_03765       CDS       T06328                                 

Gene name
recQ
Definition
(GenBank) DNA helicase RecQ
  KO
K03654  ATP-dependent DNA helicase RecQ [EC:3.6.4.12]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    EHS13_03765 (recQ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ppsc03019]
    EHS13_03765 (recQ)
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_03765 (recQ)
Enzymes [BR:ppsc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     EHS13_03765 (recQ)
Messenger RNA biogenesis [BR:ppsc03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Helicases
     EHS13_03765 (recQ)
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      EHS13_03765 (recQ)
SSDB
Motif
Pfam: RQC HRDC Helicase_C DEAD RecQ_Zn_bind Helicase_Sgs1 ResIII
Other DBs
NCBI-ProteinID: QGQ94084
UniProt: A0A6B8RED6
LinkDB
Position
781352..783274
AA seq 640 aa
MLQQAQKLLKQYYGYSSFRNGQNDIISSVLAGNDVLGIMPTGGGKSICYQIPALLLPGTT
LVISPLISLMKDQIDTLDSMGIPATFINSSLTYPEVENRIQKAGKGLYKLLYIAPERLEM
ERFMVLLQKLTISMVAIDEAHCISQWGHDFRPSYRSISTLLKMLPERPIVAAFTATATPE
VVDDIVNSLSLHNTNVFRNGFDRPNLTYTVTRVADKKDYMKQWIAGRVKEAGIIYAATRK
DVDSIYEYLYKSGVSVGKYHAGLSDKERNEAQEKFLFDDVRVMVASNAFGMGIDKSNVRY
VLHYNMPRNMEAYYQEAGRAGRDGEPSECVLLFSPQDIMIQKFLIEQSQLPPDRKANESK
KLQSMIDYCHTPRCLRSYILQYFGEKDTPQSCGNCSQCNDTRERVNMTKDAQMIFSCILR
MRERYGVTLVASVLKGSKLKKLIDLGFEQLPTYGLLAHHAEKTIISRINALIAEGYLMIT
EGQYPVVKLQTIAGAVLKGTEEVWLKPEDNVAPASVKRSRSRASGSGTSSRSNRQHTGAD
AYGAFSDGAEVMADEALFERLRALRKDLAAKDRVPPYIIFPDSVLRDLSEACPTTEQAML
RIKGIGEAKYKKYGMVFLKVLAAYADEGAIFYDYTNDEWL
NT seq 1923 nt   +upstreamnt  +downstreamnt
atgctgcagcaagcacagaaacttttgaagcaatactatggttattcttcttttcgtaat
ggacaaaatgatattatcagcagtgtcttagcaggtaatgatgtgttaggcataatgccg
acgggtggcggtaagtcaatatgttaccaaattcctgcgctattgctgccagggaccacg
cttgtgatctcacccttgatttcactgatgaaggatcaaatcgatacattggatagcatg
gggattccagctacgtttattaatagctcgcttacctatccagaggtagaaaatcggatt
caaaaagcaggtaaaggcttatataaactattgtatattgcaccagaacgcttggaaatg
gaacggtttatggttctgttgcagaagctgacgatctcgatggtggcgattgacgaagcg
cattgtatttcgcaatgggggcatgattttcgtccgagctatcgttcgatttctacgtta
ttaaaaatgcttccagaacggccgattgttgctgcctttacagctacagcaactccggaa
gtagtagatgatattgtaaatagcctttctttacataatacgaatgtatttcgcaacggc
tttgaccgaccgaatttaacatacacagtcacgcgagtggctgataaaaaagattatatg
aagcaatggattgcagggcgtgttaaggaagccggtattatctatgcggctacacgtaag
gatgttgactccatttacgagtacctttataaaagtggtgtatctgtaggcaagtatcat
gcagggttatcggataaagaacggaatgaggctcaggagaagtttctatttgacgatgtg
cgtgtcatggtggcaagcaatgcctttgggatgggaattgataaatccaatgtgcgttat
gtgcttcattataatatgccccgcaatatggaggcttattaccaagaggctggccgtgcc
ggtcgtgatggagagcccagcgagtgtgtgcttttattcagcccgcaggatatcatgatt
cagaaatttctaattgagcaaagccagctgccaccagatcgcaaagccaatgaatcgaaa
aagctgcagtcgatgatcgactattgccatacgcctcgttgtttgcggagttatatcctc
caatattttggcgagaaggataccccgcaatcatgcggcaattgcagccaatgcaatgat
acgcgtgaaagagttaacatgactaaggatgcgcagatgatcttttcttgtattctgcga
atgcgggaacggtatggggtgacgctcgtagcaagcgtgctgaaggggtccaagctgaag
aagctgatagacctaggcttcgagcagcttcctacctacggcttgctggcccatcatgcg
gagaaaaccattatcagtcgcatcaatgctttaatcgcggaaggctatctgatgattacg
gaggggcaatatcccgtagtgaagctgcagactatcgcaggagctgtcctcaagggcaca
gaagaagtctggctgaagcctgaggataatgtagctccggcgagtgttaagcgcagtagg
agcagagcttcgggcagtggcactagcagtcgaagcaatcgccagcatacaggagctgat
gcatacggagcattctccgatggagcggaggtcatggcagatgaagcattattcgagcgg
ctgcgtgcactgcgtaaggacttggcagccaaggatcgggtgccgccttatattatcttt
cctgacagcgtgctgcgtgatttaagcgaggcttgcccgacaacagagcaagccatgctg
cgtataaaagggatcggcgaagccaaatataagaaatatggaatggttttcttgaaggtt
ttagcagcttatgcagatgaaggagccatattctacgattacacgaacgatgaatggctt
taa

DBGET integrated database retrieval system