KEGG   Paenibacillus psychroresistens: EHS13_03955
Entry
EHS13_03955       CDS       T06328                                 

Definition
(GenBank) 3'-5' exonuclease
  KO
K02342  DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03030  DNA replication
ppsc03430  Mismatch repair
ppsc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    EHS13_03955
   03430 Mismatch repair
    EHS13_03955
   03440 Homologous recombination
    EHS13_03955
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ppsc03032]
    EHS13_03955
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_03955
Enzymes [BR:ppsc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     EHS13_03955
DNA replication proteins [BR:ppsc03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     EHS13_03955
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     EHS13_03955
SSDB
Motif
Pfam: RNase_T DNA_pol_A_exo1 DUF5051 RNase_H_2 Pox_ser-thr_kin CAF1
Other DBs
NCBI-ProteinID: QGQ94119
UniProt: A0A6B8RCZ9
LinkDB
Position
834177..834797
AA seq 206 aa
MALINEITVFDFETTGLSAEKDQVIEMAAIRVANGQVVGEFSTLIQYDGKLSPKIIELTG
IHDEELKHGFDEVTAFKIFNRFIGNSVIVAHNAAFDLGFLHHTLMRLAKRSFNNSFIDTL
TISRERTVFPYKLTDLCARYNIELIGAHRALSDVYGCWHLYEALSKEVKIEDYINKLGYM
SKYGPPKWAPDYAVLQAQENRYEDRR
NT seq 621 nt   +upstreamnt  +downstreamnt
atggctttgattaacgaaataaccgtgtttgattttgaaacgacgggcttaagcgctgaa
aaggatcaggtcattgaaatggctgcgattcgggttgcgaatggacaggttgttggtgaa
ttcagtaccttgattcaatacgatggcaagctgtctcccaaaattatcgagctaacaggg
atacatgatgaagaattaaagcatggctttgatgaagtgactgcttttaaaatattcaat
cgtttcatcggaaatagtgtgattgtcgctcataatgctgcctttgatttaggctttcta
catcatactttaatgcgtctggcgaaacgttccttcaataactcttttatcgatacattg
acgatcagtcgcgagcggacggtttttccttataagcttacggatttatgtgcaagatat
aatattgaattgattggcgctcatcgtgctctaagtgatgtttatggctgctggcattta
tatgaagctttaagcaaagaagtgaagattgaagattacatcaataagctaggctatatg
tcgaaatatggaccacccaagtgggcgccggactatgcggtattgcaggcccaagaaaat
cgttatgaagatcgcagataa

DBGET integrated database retrieval system