KEGG   Paenibacillus psychroresistens: EHS13_04980
Entry
EHS13_04980       CDS       T06328                                 

Definition
(GenBank) methylphosphotriester-DNA--protein-cysteine methyltransferase family protein
  KO
K13530  AraC family transcriptional regulator, regulatory protein of adaptative response / methylphosphotriester-DNA alkyltransferase methyltransferase [EC:2.1.1.-]
Organism
ppsc  Paenibacillus psychroresistens
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ppsc03000]
    EHS13_04980
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_04980
Enzymes [BR:ppsc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     EHS13_04980
Transcription factors [BR:ppsc03000]
 Prokaryotic type
  Helix-turn-helix
   AraC family
    EHS13_04980
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   Direct repair
    EHS13_04980
SSDB
Motif
Pfam: Ada_Zn_binding HTH_18 HTH_AraC
Other DBs
NCBI-ProteinID: QGQ94304
UniProt: A0A6B8RF02
LinkDB
Position
complement(1071005..1071556)
AA seq 183 aa
MSNQKLSEEIWHAIATNNPIFDGKIYYGVQTTRIFCRPSCKSRIPLKEHVHIFNHIDQAL
AENFRPCKRCKPDGLKQPNEEWITQIIEWIEAHYMETLTLDKLAELFHGSPYHLHRTFKR
IKGLTPSEYIQKIRMEKAMQLLKTTQQNVMEIGVAVGIPNAAHFATLFQKNAGLSPSKYR
HSS
NT seq 552 nt   +upstreamnt  +downstreamnt
atgagtaatcaaaaactaagcgaagaaatatggcatgccattgcaaccaacaatcctatt
tttgatggaaaaatatattatggagtccagacaacccgaattttctgcagaccctcctgt
aaatcaaggatcccattaaaagagcatgtccacattttcaatcatatagatcaagctcta
gccgagaacttccgaccttgcaaaagatgcaagccagatggattgaagcagcccaatgaa
gaatggattacacaaatcatcgaatggatcgaagctcattatatggagaccttaacattg
gataaacttgccgagctttttcatggaagtccctatcatcttcatcgaacctttaaacga
attaaaggattaaccccatctgaatatatccaaaagattcgaatggagaaagctatgcag
ctcttaaagacaacacaacaaaatgttatggagataggtgtggctgttggcatacctaat
gcggcacatttcgcaacactttttcagaagaatgcaggattgtctcctagcaaatatcgc
catagctcctaa

DBGET integrated database retrieval system