KEGG   Paenibacillus psychroresistens: EHS13_07985
Entry
EHS13_07985       CDS       T06328                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    EHS13_07985
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_07985
Enzymes [BR:ppsc01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     EHS13_07985
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     EHS13_07985
SSDB
Motif
Pfam: DNA_ligase_A_M RNA_ligase DNA_ligase_A_C
Other DBs
NCBI-ProteinID: QGQ94821
UniProt: A0A6B8REB8
LinkDB
Position
1769758..1770657
AA seq 299 aa
MIPFKPMSPILVDEIPEGVEWGYQLKWDGYRIVAWIEDGHVELYSKNMLSMNSKFPELVL
ALSSLKGKYLLDGEAVILDPETQRPSFQKLQKRGRMKEEASIARAVVANPVQYIVFDLLQ
IGIEDLRKLPFRERHDRLQLAGAEWQEPLFLTDLFDNGEQLWHWVKQHKWEGIVIKRLSS
AYKKAKEHQDWFKRKTSLELEVEIVGLLMKEGRISSLVMRQDGLYRGRNSSGLNGDIKAR
LGLLPAAKKRSDYFQELPEGLRGETVLWLDSPFIAEVTGVELTEAGTLRHPRIIGLQLK
NT seq 900 nt   +upstreamnt  +downstreamnt
atgattccttttaaacctatgtcacctattctagtcgatgaaattcctgaaggagtggaa
tggggatatcagcttaaatgggatggttatcgaatcgtggcttggattgaagatggacat
gtggagctttattcgaaaaatatgttgagtatgaatagtaaatttcccgagttggtatta
gctttatcttcgttaaagggaaagtatttgttggatggagaagcggttattctcgaccca
gagactcagcgtcccagctttcaaaagctgcaaaaacgtggacgtatgaaagaggaagca
tccatagcaagggcagtagtcgcaaatccggttcagtacatagtttttgatttattgcag
attggtatagaggatttgcggaagttgcctttcagagaaaggcatgatcgtcttcagctt
gcaggggcagaatggcaggagccgctattccttaccgatctttttgataatggggagcag
ttgtggcactgggtcaagcagcataaatgggaaggtatcgtcatcaagagattatccagc
gcatataaaaaagctaaagagcatcaggactggtttaagcgcaaaacgagcttagagcta
gaggtggaaatcgttggccttctaatgaaagaggggaggatatcaagcttagttatgcgg
caagacggtctttatagagggagaaattcatcaggattgaatggggatataaaagctcga
ttagggttattgccggcagctaaaaagaggagtgattattttcaggagcttccagaagga
ctgcgaggagaaacagtgctctggttagatagcccatttattgctgaggttacaggagtg
gaactgacagaagccggtactttgagacatccgagaatcattggtttacagcttaagtaa

DBGET integrated database retrieval system