KEGG   Paenibacillus psychroresistens: EHS13_08635
Entry
EHS13_08635       CDS       T06328                                 

Gene name
uvrC
Definition
(GenBank) excinuclease ABC subunit UvrC
  KO
K03703  excinuclease ABC subunit C
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    EHS13_08635 (uvrC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_08635 (uvrC)
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     EHS13_08635 (uvrC)
SSDB
Motif
Pfam: UvrC_HhH_N HHH_5 GIY-YIG UVR HHH_2 5_3_exonuc
Other DBs
NCBI-ProteinID: QGQ94941
UniProt: A0A6B8REM2
LinkDB
Position
1921091..1923049
AA seq 652 aa
MSENYREAIKQKLALLPDQPGCYIMKNSEGTIIYVGKAKVLKNRVRSYFTGGHNIKTQLL
VSEIADFEYIMTGNNVEALILECNLIKKHLPRYNVLLKDDKTFPYIKITHEEHPRLEITR
KVYKDKGKYFGPYPNGYAAQETKKLLDRLYPLRKCRTLPEKVCLYYHLGQCVAPCEFEVE
QSQYDKMIQEITRFLGGGHEQIRAELEKKMLESSEEMNFERAKELRDQMLSIDAVMQKQK
VNSADIMDRDVFGYAVDKGWMCVHILYMRQGKMIARHASVFPYYGEDYEDFISYVTQYYS
ENPALPKEIFLPEQQDKKNNGKIQIANVGPVVNTEPAVNTESAKVEVPNLELLEIELTET
DEIKTELNLALESWLKVRVFEPKRGTKKQLVDMAIQNAVGALNEKFNLIDRDEKRTTKAV
ENLGTWLGTPTIRRIEAFDNSNIMGSDPVSAMVVFIDGKPARKEYRKYKVKTVIGPDDYG
TMREVIRRRYERMLKENLPPPDLIVIDGGKGQISAAQDVLENELGLYIPVCGLVKDAKHK
TAQLMSGDPPEVVPLPRDSQEFYLLQRIQDEVHRFAITFHRETRAKSMVASKLDEIPGIG
EKRRKQLLKHFGSLKKIKIASIEDFQAMGIGSKLAQTILTALQDQETPNDLD
NT seq 1959 nt   +upstreamnt  +downstreamnt
atgagtgagaactatcgcgaggcgattaaacaaaagctagcgctgctgcccgatcagccg
ggctgttacattatgaagaactctgaaggtacgatcatttatgtaggcaaagcgaaggta
ttgaaaaaccgcgtgcgctcttattttacgggcggccataacattaagacccagctgctt
gttagtgaaattgccgattttgaatatatcatgacaggcaataatgtggaagcgcttatt
ctcgagtgcaatctaatcaagaagcatcttccgcgatacaacgtgctgcttaaggatgat
aaaacctttccttatattaaaataactcatgaggagcacccgcgactcgagattacccgt
aaggtttataaagataagggcaagtattttggtccttatccgaatggttatgcggctcaa
gaaacgaagaagctgctggaccgcttgtacccattgcgcaaatgtcgcactttacctgag
aaggtttgtttgtactatcatcttggacaatgcgttgcgccttgtgagttcgaagtcgag
caaagtcaatatgataaaatgattcaagagattacaaggtttcttggaggcggacacgag
caaattagggctgagttagagaagaaaatgttggagtcatccgaggaaatgaattttgaa
cgtgctaaggaattgcgggatcagatgttatcgattgatgcagtcatgcaaaaacaaaaa
gttaattctgcggatattatggatcgtgatgtttttggctatgctgtagataaaggctgg
atgtgtgtacatattctctatatgcgtcaaggcaaaatgatcgcacgccatgcttccgtt
ttcccttattatggtgaagactatgaggatttcatctcctatgttactcaatattatagt
gagaacccagctctgcctaaagagatattcctgcccgaacagcaagataagaagaacaat
ggcaaaatacaaattgctaatgttggacctgttgttaatacagaacctgctgttaataca
gaatctgcaaaagttgaagtcccaaatttagagctgctagagatcgaactcaccgaaaca
gatgagatcaaaacagagctgaatctagcactggagtcatggcttaaagtgagggtattc
gagccaaagcgagggacgaagaagcagctagtcgatatggctattcaaaatgcggttggt
gctttgaacgagaagttcaatttaatagaccgagatgagaagagaactacgaaagctgta
gagaatttagggacttggttaggcacaccaacaattcggcggattgaggcttttgataat
tcgaatattatgggtagtgatcctgtatccgcaatggttgttttcatagacggaaagcca
gcacgtaaggaataccgcaagtacaaggtgaaaacagtcattggcccagatgattatggg
acaatgcgcgaggtcattcgtcgtcgatatgaacgcatgctgaaggaaaaccttcccccg
cctgatctgattgtaattgatggagggaaaggtcagatatctgcagcacaggatgtgctt
gagaatgagctaggtttatatattcctgtatgtggattagtaaaggacgccaagcataaa
accgcgcaattaatgagtggtgacccgcctgaggtagttcctttgccgagagacagccaa
gaattctatttgttgcagcggattcaagatgaagtgcatcgctttgccattacctttcac
cgagaaacacgagctaaatcgatggtggcctctaagctggatgagattcctggaatcggg
gagaagcgtcgaaagcagctattgaagcattttggttcattgaaaaaaattaaaatagcc
tctattgaggattttcaggctatggggattggcagcaagctggctcaaaccatattaact
gctttgcaggatcaagagacgccaaatgatctggactga

DBGET integrated database retrieval system