KEGG   Paenibacillus psychroresistens: EHS13_10255
Entry
EHS13_10255       CDS       T06328                                 

Definition
(GenBank) uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    EHS13_10255
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_10255
Enzymes [BR:ppsc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     EHS13_10255
DNA repair and recombination proteins [BR:ppsc03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     EHS13_10255
 Prokaryotic type
     EHS13_10255
SSDB
Motif
Pfam: UDG
Other DBs
NCBI-ProteinID: QGQ95242
UniProt: A0A6B8RI61
LinkDB
Position
2322791..2323471
AA seq 226 aa
MIQIQDDWKVLLEEEFAKPYYLKLMTTLEEEYQTKVVYPNRADLFTALQATSYANTKVVI
LGQDPYHGAGQAHGLSFSVQPGVPLPPSLKNIFIELQSDVDFNIPNHGCLHSWAEQGVLL
LNTVMTVRAGEANSHKKIGWQQFTNLIISLLNARVNPVVFILWGNGAQQKTELITNPKHL
VIQSVHPSPLSSYRGFFGSKPFSAANRFLRQNGSALIDWQLPMDAY
NT seq 681 nt   +upstreamnt  +downstreamnt
atgatacaaatccaagatgattggaaagtgctgttggaagaggaatttgcaaagccttat
tacttaaagctaatgacgacgctagaggaagaataccagactaaggtggtatatcccaac
cgagctgatttgtttactgcattgcaggcaacttcctatgcgaatacgaaggttgtcatt
cttgggcaagatccttatcatggtgctggtcaagcgcatggtctaagcttttctgtccaa
cctggcgtaccgcttccaccctcgctaaagaatattttcatagagctgcaatcggatgta
gatttcaatatccccaatcatggttgcttgcattcttgggcagagcaaggtgtcttattg
ctcaatactgtcatgactgttcgtgcgggtgaagcaaattcacataagaaaataggctgg
cagcaattcaccaacctaattattagtctattgaatgcacgtgtgaatcctgttgtcttc
attctatgggggaatggggctcaacaaaaaaccgaattaattactaatcccaagcatctc
gtgattcaatccgtacatccaagccccttatcctcttatagaggattctttggcagcaaa
ccgttttctgcagcaaaccgtttcctacggcaaaacggcagtgctctgatagattggcag
ctgccaatggatgcctattaa

DBGET integrated database retrieval system