KEGG   Paenibacillus psychroresistens: EHS13_11225
Entry
EHS13_11225       CDS       T06328                                 

Gene name
ruvC
Definition
(GenBank) crossover junction endodeoxyribonuclease RuvC
  KO
K01159  crossover junction endodeoxyribonuclease RuvC [EC:3.1.22.4]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    EHS13_11225 (ruvC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_11225 (ruvC)
Enzymes [BR:ppsc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.4  crossover junction endodeoxyribonuclease
     EHS13_11225 (ruvC)
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     EHS13_11225 (ruvC)
    RecFOR pathway proteins
     EHS13_11225 (ruvC)
SSDB
Motif
Pfam: RuvC DUF3882 WG_beta_rep FaeA RuvX BHD_3
Other DBs
NCBI-ProteinID: QGQ95414
UniProt: A0A6B8RI48
LinkDB
Position
2529396..2529899
AA seq 167 aa
MRILGIDPGIAIVGFGFIDKEGSKLVPVQYGAIQTDSKTESSLRLKQVYDTLGELIDRYK
PDAVAIEKLFFNKNVTTAFTVAEARGVMILAAVQRGLPVAEYTPLQVKQAIVGYGRAEKK
QVQEMVRIFLKLSAVPKPDDVADALAIAICHAHSYLLTQKINEVVKR
NT seq 504 nt   +upstreamnt  +downstreamnt
gtgcgcattctaggtattgaccccggtattgctattgttggatttggatttatcgataaa
gagggcagtaaattggttcccgttcaatatggcgccatccaaacagattcaaaaacagaa
agttccctgcgattaaagcaggtttatgatacactaggtgaattgatcgaccgttataag
ccagatgctgtggcgatagagaagcttttcttcaataaaaatgtcacaactgcttttaca
gttgctgaagctagaggtgttatgatcttagcagcagtccagcgagggctcccggttgct
gagtatacaccactccaagtaaaacaagccattgttggctacggacgtgcagagaaaaaa
caagttcaagagatggttcgtatttttctgaaattatcagcagttcctaagccggatgat
gtggcggatgcgctagccattgctatttgccatgcccattcctatttgcttacacaaaag
ataaatgaggttgtgaaacgatga

DBGET integrated database retrieval system