KEGG   Paenibacillus psychroresistens: EHS13_11230
Entry
EHS13_11230       CDS       T06328                                 

Gene name
ruvA
Definition
(GenBank) Holliday junction branch migration protein RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    EHS13_11230 (ruvA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_11230 (ruvA)
Enzymes [BR:ppsc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     EHS13_11230 (ruvA)
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     EHS13_11230 (ruvA)
    RecFOR pathway proteins
     EHS13_11230 (ruvA)
SSDB
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH HHH_3 IMS_HHH HHH_8
Other DBs
NCBI-ProteinID: QGQ95415
UniProt: A0A6B8RII9
LinkDB
Position
2529896..2530528
AA seq 210 aa
MIDFLRGHIVHREVDYIVLDVHGVGYRLFCANPLAIQQETGKEIVLYVHHNVREDAVTLF
GFQSREEQTLFRRLLIVTGIGPRVALGILSYGRPEVIVSAIYQEDIDFLVKLPGIGRKTA
QRIVLDLKDKLGDLPMLQTPAAGQMTIPTSSTGSSRSGGLAWQEAKMALIALGYTEAELD
RIWPKVQQNANNGVTTDVLIKQALQALFKG
NT seq 633 nt   +upstreamnt  +downstreamnt
atgatagattttctgagaggtcatattgtacatagggaagtagattatattgtgctggat
gtgcatggagtgggatatcgcctattctgtgcgaatccattagccatccaacaagaaaca
ggtaaagaaattgttctatacgttcaccataatgttcgtgaggatgctgtgactttgttt
ggattccaatcacgcgaggagcagacgttatttcgtaggctgttaattgttacaggaatt
ggtccgcgtgtggcgcttggcattctttcttatggtcgcccagaagtgattgtttcggct
atatatcaagaggatattgatttcttggttaagctgcctgggatcggaagaaagacagcg
cagcgtattgtactggatttgaaggataaactaggtgatttgccaatgctgcaaacgccg
gcagctggacaaatgactattccgacttcttcaactggttcttctcgttctggaggattg
gcttggcaagaggctaaaatggctttgattgcgcttggttatacagaagcagaattggat
cgaatttggccaaaagtgcaacaaaacgcgaataatggcgtaacaacggatgtattaatt
aagcaagctcttcaagcgcttttcaaaggatag

DBGET integrated database retrieval system