KEGG   Paenibacillus psychroresistens: EHS13_11235
Entry
EHS13_11235       CDS       T06328                                 

Gene name
ruvB
Definition
(GenBank) Holliday junction branch migration DNA helicase RuvB
  KO
K03551  holliday junction DNA helicase RuvB [EC:3.6.4.12]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    EHS13_11235 (ruvB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_11235 (ruvB)
Enzymes [BR:ppsc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     EHS13_11235 (ruvB)
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     EHS13_11235 (ruvB)
    RecFOR pathway proteins
     EHS13_11235 (ruvB)
SSDB
Motif
Pfam: RuvB_N AAA_lid_4 RuvB_C AAA AAA_5 Mg_chelatase TIP49 AAA_16 TsaE AAA_22 AAA_14 NTPase_1 Sigma54_activ_2 AAA_3 RNA_helicase Bac_DnaA AAA_18 NB-ARC Rad17 MCM AAA_24 AAA_33 IstB_IS21 Resolvase DUF815 AAA_17 AAA_28 ABC_tran RsgA_GTPase AAA_13
Other DBs
NCBI-ProteinID: QGQ95416
UniProt: A0A6B8RJ52
LinkDB
Position
2530589..2531593
AA seq 334 aa
MEDRLISANLMMEDQVVELSLRPRYLAEYIGQTQVKENLKVYIEAAKMRKEALDHVLLYG
PPGLGKTTLSNIIANELGVNIRVTSGPAIERPGDLAAILTNLQEGDVLFIDEIHRLQRTV
EEVLYPAMEDFALDIMIGKGPSARSVRLDLPAFTLIGATTRAGLLSSPLRDRFGVVSRLE
YYTIDELTFIVTRASEILQVPIVGEAAHEIGMRSRGTPRIANRILKRVRDYAQVRGDGVI
TLELAKSALQLLQIDDLGLDQIDHKMIRTIITNFQGGPVGLDTIAATIGEESQTIEDVYE
PFLLQIGFLQRTPRGRTVTPLAYKHLGMQPPEPK
NT seq 1005 nt   +upstreamnt  +downstreamnt
atggaagatcgacttatatcggccaatcttatgatggaagatcaggtagtggaattgagt
ctgcgtccgcgatacttggctgaatatattggacaaacacaggttaaagaaaaccttaag
gtttatattgaagcggccaaaatgcgcaaggaagccttggatcatgtcttgttgtatggt
ccgccaggattaggcaagacgactttatccaacattattgctaatgagcttggtgtcaat
ataagagtaacctcaggacccgctatagaacggcccggtgatttggcagcaattctaacg
aatctgcaagaaggcgatgtgctttttatcgacgaaattcaccgtctacagcgtacagtt
gaagaagtgctttatccggcaatggaagactttgcactcgatattatgataggtaagggt
ccaagcgcacgttccgtgcgtttggatttgcctgccttcacacttattggggcaacaacc
cgagcaggcttgctctcatcaccattacgggatcgctttggagtggttagccgcttagaa
tattatacgattgatgagctaacctttatcgttacacgtgcgtctgaaatcctgcaggta
cccatagttggtgaagccgcacatgagattggcatgcgttcccgagggacaccgcggatt
gcgaatcgaattttaaagcgcgtaagagattatgcccaagtacgtggtgacggggttatc
acattggagctagccaaaagcgccttgcaattattgcaaattgacgatctgggcttggat
caaatcgatcataaaatgattcgtaccataattaccaattttcaaggtgggcctgttggt
ttggatacaattgccgctacgattggtgaggaaagtcagacaatcgaagatgtctatgag
ccttttctcttgcagatcggttttctgcaacggactcctcgcggaagaacagtaactcct
ttagcctacaagcatcttggtatgcagccgcctgaacccaaataa

DBGET integrated database retrieval system