KEGG   Paenibacillus psychroresistens: EHS13_11300
Entry
EHS13_11300       CDS       T06328                                 

Gene name
recJ
Definition
(GenBank) single-stranded-DNA-specific exonuclease RecJ
  KO
K07462  single-stranded-DNA-specific exonuclease [EC:3.1.-.-]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03410  Base excision repair
ppsc03430  Mismatch repair
ppsc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    EHS13_11300 (recJ)
   03430 Mismatch repair
    EHS13_11300 (recJ)
   03440 Homologous recombination
    EHS13_11300 (recJ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_11300 (recJ)
Enzymes [BR:ppsc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     EHS13_11300 (recJ)
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    RecJ
     EHS13_11300 (recJ)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     EHS13_11300 (recJ)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      EHS13_11300 (recJ)
SSDB
Motif
Pfam: ssDNA-exonuc_C RecJ_OB DHHA1 DHH Herpes_U30
Other DBs
NCBI-ProteinID: QGQ95427
UniProt: A0A6B8RHR4
LinkDB
Position
2544519..2546975
AA seq 818 aa
MLQSKARWNIRQGDETIELQLVEALKISPLIAKLLVTRGIKTEVDARHFLGADEAHFHDP
YLLDGMTEAVERIRKALTHNEKIRIYGDYDADGVSSTSLMVFLLKTLNANFDYYIPHRVN
EGYGLNKNALELAKKSGVSLLITVDTGISATEEIDYANEIGLDVIVTDHHEPPELLPQAF
AIINPKKPGCPYPFKQLAGVGVAFKLAHALLGRLPHELLEMATLGTIADLMPLQDENRLM
VKLGLERLRSTALPGFKALLNVSGIERGAVTASHIGFSVAPRINASGRLDSADTAVRLLT
TDNEQEAEHLAFDLDVLNKERQRIVEEMLTEALLMVEKDPNFHERKVIILAKEDWNVGVI
GIVASKLLERYYRPTIIMGIDAKTGLAKGSARSIVGFDLYKALSESADLFLHYGGHQAAA
GMTIQQDRIPELGRRLELLAEQWLSPEDFLPIMQADLVCDLKEMPLEMIQQLEQLAPYGM
GNPSPRFIFRGLGIDEMKTMGREQQHLKLVLIESKGEAACSIEAIAFGKGTLSMLISSTA
QVDVYGELSVNEWNGKRKPQLMMQDIQVQQSQLFDWRGTKDFEKRWTEVASRSLTAQSSA
GMDKTKKSTVAIVVFDEAEKAKLPQALTMLGCSIWLADSSGNIQPLNSFARDSIYAQCKD
VIYYFLPSSLKPLRISLSLATSAERIYTLFHDSDPTQHTAIPGRDLFKSVYGTIQQKPNM
DMNSLSVSFSKRSGLTPPMIRFILDVFEELGLIEQIGQRYTCTLAPQKRELSTSERYQMR
LQRQEVEQTLLYSSALDLSRWMLPQLAALLKDSIEAYA
NT seq 2457 nt   +upstreamnt  +downstreamnt
atgctccaatccaaggctagatggaatattcgccaaggtgatgaaacgattgagctgcag
cttgttgaagcgctaaaaatcagcccgttaattgctaaattattagtcactcgtggaatc
aaaacggaggtggatgccagacattttctgggtgcggatgaagcgcattttcacgatccc
tatttacttgatggcatgactgaggcagtagagcgaattcgaaaagcattgacgcacaat
gaaaaaattcgcatttatggtgattatgatgctgacggtgttagcagtacttcgttaatg
gtattccttctaaaaacgttaaatgcgaattttgattattatattccccatcgcgtcaat
gaaggctacggtttgaataaaaatgcgcttgagcttgctaagaaaagtggagtttccctt
ctaatcacagtggatacggggataagtgcaacagaggaaattgattatgccaatgagatt
ggtttggatgttattgtcacagatcatcatgagccgccagagctgctgcctcaagcattt
gcaatcataaaccctaaaaaaccgggttgtccgtatccttttaaacagcttgctggtgtg
ggtgtagcctttaagcttgcccatgcgttattgggtagattgcctcatgagctgcttgaa
atggctacacttgggacaattgctgacttaatgccgcttcaggatgaaaatcgattaatg
gttaagctcggcttggaacgcttgcggtcaacggcacttccagggtttaaagctttgttg
aacgtctcaggcatcgaacgaggtgcggttacagcttctcatatcggcttttcagtagcg
ccaagaatcaacgcaagcggccgcttagatagcgcggatactgctgtaaggttacttaca
accgataatgaacaggaagcggagcatctagcttttgatttggatgtactgaataaagag
cgtcagcgaatcgtcgaagagatgctaacggaagcattgctgatggttgagaaggatcca
aacttccatgaacgtaaagtaattattctggcaaaagaagattggaatgtcggcgtaatc
ggaattgtcgcttccaagcttttggaaagatattatcgtccgaccataattatggggatc
gacgctaaaacaggcttagctaaaggctcggcacgctccattgtcggctttgatctgtat
aaagcattatccgagtcagctgatttattccttcattacggagggcatcaagcagcagca
ggcatgacgattcaacaagatcggattcctgagcttggtcgtcgattagagcttctcgcc
gaacaatggcttagtccagaggattttttaccgattatgcaagcagatctggtttgtgac
ctgaaagaaatgccgcttgaaatgatccagcagcttgaacaattggctccctatggaatg
ggaaatccatcgcctcgctttatctttcgtgggttggggattgatgagatgaaaaccatg
ggaagagaacagcagcatcttaaactggtattgattgaatccaagggcgaggcagcttgt
tcgatagaagccatagcatttggcaaaggcacactctccatgttaatctcatctacagcc
caggttgatgtctacggtgagctatctgtaaacgaatggaacgggaaacgtaagccccag
ctgatgatgcaggatattcaagttcagcagtctcaattatttgattggcgtggcacgaag
gattttgagaaacgatggacggaagttgcctcgagaagcttaacagctcaatcttcggca
gggatggataaaaccaagaaaagcaccgtagccattgttgtttttgatgaggctgagaaa
gctaagcttcctcaagcattaaccatgcttggctgttcgatctggctggcagattcctca
gggaatattcagcctttgaactcttttgccagggattctatatatgctcagtgcaaggat
gttatctattacttcttaccctcaagcttgaagccattgcggatatcattgtcattagcg
actagtgcagaacgcatatatacgttattccatgattcggatccaactcaacacacagcc
atacccggtagagatttattcaaaagtgtttatgggacgattcagcagaagcctaatatg
gatatgaacagtttatcggtatcgttcagtaaacgatcgggactaacaccacctatgatt
cgttttatcctcgatgtattcgaagagcttggcttgatcgaacagattggtcagcgatat
acctgtactttagcaccacagaaacgtgaattgtctacttctgaacgttatcagatgaga
ttgcagcgtcaggaagtagagcaaaccttattgtatagctcggcactagatctgagtcgc
tggatgcttccacagctcgcagctttacttaaagattcgattgaagcttatgcataa

DBGET integrated database retrieval system