KEGG   Paenibacillus psychroresistens: EHS13_12385
Entry
EHS13_12385       CDS       T06328                                 

Definition
(GenBank) 8-oxo-dGTP diphosphatase
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
ppsc  Paenibacillus psychroresistens
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_12385
Enzymes [BR:ppsc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     EHS13_12385
DNA repair and recombination proteins [BR:ppsc03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    EHS13_12385
 Prokaryotic type
    EHS13_12385
SSDB
Motif
Pfam: NUDIX NUDIX_4
Other DBs
NCBI-ProteinID: QGQ95623
UniProt: A0A6B8RJ94
LinkDB
Position
2783592..2784086
AA seq 164 aa
MSELQNVGCGIYTMVLVQDGDKVLLLNRPDKLGFPGYLGPGGKVDIPESITEGAVRELWE
ETGLRIKPENLIYKGLDGYVVPNTNYRYMVFNYLVQIYEGELLQNPPEGELVWVNINEAL
DLPMQPWFVRRFPLFFKEGTFEITAIRDEEGNKVMDDKVVKLQG
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtcagaattgcaaaatgtaggctgcggcatttatacgatggttcttgttcaggatgga
gataaggttttgcttctcaatcgtcccgataaactcgggtttccgggttatcttgggcca
ggtggcaaggtggacattcctgaaagtattacggaaggagccgtccgtgagttatgggaa
gaaacggggctgcggataaaaccagagaatttgatctataaaggacttgacggatacgtt
gtgcctaatacgaattatcgatatatggtttttaactacttggtccaaatttatgaaggc
gagttgctgcaaaatcctccagaaggtgagttggtgtgggttaatattaatgaagccttg
gatttgccgatgcagccgtggttcgttcgaagatttccgctttttttcaaggagggtact
ttcgaaataacagcaattcgggatgaagagggaaacaaagtcatggatgataaagtagtg
aagctacaaggttaa

DBGET integrated database retrieval system