KEGG   Paenibacillus psychroresistens: EHS13_12410
Entry
EHS13_12410       CDS       T06328                                 

Definition
(GenBank) DEAD/DEAH box helicase
  KO
K11927  ATP-dependent RNA helicase RhlE [EC:3.6.4.13]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    EHS13_12410
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ppsc03019]
    EHS13_12410
Enzymes [BR:ppsc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     EHS13_12410
Messenger RNA biogenesis [BR:ppsc03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Helicases
     EHS13_12410
SSDB
Motif
Pfam: DEAD Helicase_C ResIII AAA_19 UTP25 AAA_22
Other DBs
NCBI-ProteinID: QGQ95628
UniProt: A0A6B8RJW4
LinkDB
Position
2788940..2790202
AA seq 420 aa
MTFNDLNIIPEILKALSKENYTTPTPIQEQAIPAVLAGRDLLGCAQTGTGKTAAFAVPII
QLLMEQPRKPNIQGRVRSLILTPTRELALQIDENIRAYSQFTDLRCSAIVGGVSQKAQER
ALNKGADIIIATPGRLIDLIGQKRIDLQYVSILVLDEADRMLDMGFINDVKKIITKMPSK
RQTLFFSATMPPEISKMVKTLLVNPVKVEITPVSSTVDRIQQSLYLVDKANKQNQLNHLL
QDKSIVSALVFTRTKHGADRVTKELAKVKISAQAIHGNKSQSARQNALSNFKSGVTRVLV
ATDIAARGIDIDELSHVINFNLPNIPETYVHRIGRTGRAGLSGVAISFCELEEIPFLKDI
EKLIGKNIPEVTDHLYPLLGAVPARLEVKQAAAVIKPVKPKANPARKPKAEWFSKSRTSK
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgacatttaacgacttaaatattataccggaaattctaaaagcattaagcaaagaaaac
tatactacacccacacctatacaagaacaagctatacctgctgtgttagctggccgagat
ttgcttggctgtgctcaaacaggaacgggaaagacggcagcattcgctgtgccaattatt
cagttattaatggaacagcctaggaagccaaatatacaaggtcgtgttcggtcattgata
ttaacaccaacaagagagctcgcattacagattgatgaaaacattcgtgcgtacagccaa
ttcactgatttgagatgttcggctattgtcggcggcgtttcacaaaaagcacaagagcgg
gcactcaataaaggcgcggatattattatcgcaactccaggccgacttatcgacttaatt
ggtcaaaagcgaattgatttacaatacgtctctatcttagttctagatgaagctgacaga
atgctcgatatgggcttcatcaacgatgtgaagaaaatcatcactaaaatgcctagcaaa
cgacaaactttattcttctcggccacaatgccgccagaaatctccaaaatggttaagaca
ctgcttgttaaccctgtaaaggttgaaattaccccggtatcttcaacggtggataggatt
caacaatctctttacttagtcgataaggcaaataagcaaaatcaattgaatcatctttta
caggataaatcgattgtatctgcattggtatttacacgtaccaagcatggcgctgatcgt
gttactaaagagttagctaaagtgaaaatttctgcccaagctattcatggcaataaatct
caatcagcccgtcaaaatgcattaagtaatttcaagagtggcgtaacaagggtgttggta
gctactgatatcgctgctcgagggattgatatcgatgagctttcccatgtgattaacttt
aatcttcccaatatcccagaaacctatgttcatcgtattggtcggacaggcagagcggga
ttaagcggggttgcaatctccttttgcgagcttgaagaaattccatttcttaaggatatc
gagaaattgattggaaagaatattcctgaagttaccgaccatctgtatccgctgctaggt
gcagttcctgcaaggctagaagtaaagcaggcagcagccgtaattaaaccagttaaaccg
aaagctaacccagctcgcaaacctaaggccgaatggtttagtaaaagtagaacgagtaag
taa

DBGET integrated database retrieval system