KEGG   Paenibacillus psychroresistens: EHS13_12780
Entry
EHS13_12780       CDS       T06328                                 

Gene name
holA
Definition
(GenBank) DNA polymerase III subunit delta
  KO
K02340  DNA polymerase III subunit delta [EC:2.7.7.7]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03030  DNA replication
ppsc03430  Mismatch repair
ppsc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    EHS13_12780 (holA)
   03430 Mismatch repair
    EHS13_12780 (holA)
   03440 Homologous recombination
    EHS13_12780 (holA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ppsc03032]
    EHS13_12780 (holA)
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_12780 (holA)
Enzymes [BR:ppsc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     EHS13_12780 (holA)
DNA replication proteins [BR:ppsc03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     EHS13_12780 (holA)
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     EHS13_12780 (holA)
SSDB
Motif
Pfam: DNA_pol3_delta HTH_37 HTH_38
Other DBs
NCBI-ProteinID: QGQ95694
UniProt: A0A6B8RIX2
LinkDB
Position
2864207..2865226
AA seq 339 aa
MDYKTAAKGITQGNSLPIYVCYGTEKYLQQEFIQHVIDKLIEPDQRSFAVSRYDLSETSL
DTVLDDAETMPFLADKKIVIAKNALFFTGAKESTKVEHRIERLLEYLKSPVDYAIIIFVV
DADKLDERKKIVKALKESQSAIPFLPLSVDELSRWISRRADKWGVTFEDGAIDKFILYTG
AQLQILTSELEKLSLFVGPNGCITGELIGQLVVRSAEQNVFILMDEIVKQRLDNALSIFH
DLLKQKEEPIKILLLIARQFRIMLQIKELEQQGYSQQQIAGQIGAHPYAVKLASEQGRSY
SLAKLSGLLSQLGDLDYRMKSGKVEKALGLELFILEIPS
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggattataaaacagcagccaaggggattacccaaggcaattctttacctatctatgta
tgctatggcacggaaaaatatttgcagcaggaatttattcaacatgtaattgataaactg
attgaaccagatcaaagatcatttgctgtaagtcgctatgacttaagtgaaacgagcctg
gatactgtgctagatgatgctgaaactatgccatttctggcagataagaaaattgtaatt
gccaagaatgcccttttttttacaggcgctaaagaaagcactaaagtcgagcatcggatt
gaacgacttttggagtatctgaaatcacctgtcgattatgcaataattatctttgtagtg
gatgcggacaagctggatgaacgaaagaaaatcgtcaaagcacttaaagaaagtcagagc
gcaattccttttttaccgttatctgtagatgagctttctcgttggataagtcgtagagca
gataaatggggagttacctttgaagatggagccatcgacaaatttattctttatacaggc
gctcagctgcaaattcttacatcggagctcgagaagctctcgctttttgttggtcctaat
ggctgtatcactggtgaattaattgggcagcttgtcgtgcggagtgcggagcagaatgtt
tttatcctcatggatgaaattgttaaacaacgcttggataatgccttatcgatctttcat
gatttattaaagcagaaagaagagccgattaaaatcttattgctgatagctcgccaattc
cgaattatgctgcaaattaaagagctagagcagcaaggctactcccagcagcaaattgct
ggtcaaatcggggctcacccttatgcagtcaagctagcctctgagcaggggcgcagctac
tccttagcgaagctcagcgggttattatcgcaattaggagatctggactatagaatgaaa
agtggcaaggttgagaaggcattaggattagagctgttcatccttgaaattccaagctga

DBGET integrated database retrieval system