KEGG   Paenibacillus psychroresistens: EHS13_12895
Entry
EHS13_12895       CDS       T06328                                 

Gene name
addB
Definition
(GenBank) helicase-exonuclease AddAB subunit AddB
  KO
K16899  ATP-dependent helicase/nuclease subunit B [EC:3.1.-.- 3.6.4.12]
Organism
ppsc  Paenibacillus psychroresistens
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_12895 (addB)
Enzymes [BR:ppsc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     EHS13_12895 (addB)
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     EHS13_12895 (addB)
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    AddAB pathway proteins
     EHS13_12895 (addB)
SSDB
Motif
Pfam: PDDEXK_1 Exonuc_V_gamma UPF0179
Other DBs
NCBI-ProteinID: QGQ95714
UniProt: A0A6B8RIZ6
LinkDB
Position
2888477..2892070
AA seq 1197 aa
MAIRFIIGRAGSGKSRRCLDEIRQQLADNPQGNPLILLVPEQATFQAEVALVSTPGLSGI
IRAQVLSFRRLAWRVMQETGDTAKLPIDDIGKIMLLQRILHKHDAELKLFQSSQEKMGFL
ERLNAFFSELKRYCITADVLKDYYAKKIISKEIEGSTSLLADKLHDLLVLYSEFEKLLAL
QYLDGEDYLANLAKQLQKSTGVCEADLWIDGFFGFTPQEQEAVLQCMRYCRSVTITLCLD
RAYSVGERPDELNLFHPTAVTMVRLQEQLEALGMFTNEVVVLGENELPRFRKSPMLAHLE
RNYEQRLSPRRKHYPAVAEEALNESIHLYAAVHRRAEVEGAAREIRRVVREKHLRWRDIA
VRVRNIEAYGDLLASVFDDYSIPYFFDQKSTMMFHPLVEFIRSALEVVLHNWQSDAVFRC
VKTDFLLPLNKESSGIVDRKAMDELENYVLAYGIQGYRWLEAKSWEIRRFNSLEDEEATA
KDEDTLALKRIQASSQLIIKPLSQLQQRMKQSETLQQRTEALYTMLSDSGVPERLQQWGD
EALAAGNPQKAREHSQVWDHVMNMLDQMVEMMGAEEVSLELFVQLLDAGLESIRLALVPP
SLDQILIGSIDRTRTAQVKIAFVLGVNDGVLPQRMNEDGLISENERELLSELGLHLADGS
RRKLLDEQFLIYTVLCAPSDYLWLSYPLADEEGKSLLPSEIIKQVKSLFPLMQERLLLAG
PEGSLSEQAQMSFIAQPERALSYLTVQMKLALRGAEIAPLWWHIYNWFAVQADWRDKLQR
MMRSLLFTNSEPALAETTRVQLYGDHLRASVSRMERFVACPFSQFVSHGLRLQERRIYRL
EAPDIGQLYHAALNALVKDMQQEGVLWGMLSLEQLTERASLIIDRLTPRLQSEILLSSAR
YRYIAFKLKNIIGRAAVMLAEHVRRGAFVPVELELGFGPGQTLPALSFQLNNGFAMDIIG
RIDRVDRAEGAEGALLRIIDYKSSSTSLKLAEVYHGLSLQMLTYLDVVITHAERWIGQKA
IPAGVLYFHVHNPMIQSKNALQSEEVEKELKKRFKTRGLVLAETEAIGFMDHDLSGGSGR
SSIIPVALKNDGSFYKNASVATRAEWSLLQSHVRQTIRVIGTRITNGEVSVEPYRMGEQI
ACTFCNYKSICEFDPLFAGNDYRIIQPRSNEQVWQAMALDIAGESVMDIPLKQKGVQ
NT seq 3594 nt   +upstreamnt  +downstreamnt
atggcgattcgatttataataggacgagctggcagcggcaaaagcagacgttgtttggat
gagattcgtcagcagctagctgataatccgcaagggaatccactcattctgcttgtacct
gagcaagcaacctttcaagctgaggttgccttggtttcaacacctggtttaagtggaatt
atccgagctcaggtgctaagttttcggcggctagcatggcgagttatgcaggaaacaggt
gatacagctaagcttcccatagatgatataggcaaaataatgctattacagcgtatttta
cataaacatgatgcagaattgaagctgtttcaaagctcacaggaaaaaatgggctttctc
gagcgattgaatgctttttttagtgagttaaaacgttattgtataacggcagatgtctta
aaggattactatgcaaaaaaaataatctcaaaagagatcgagggaagtacctctttatta
gctgataaattacatgatttgttggttctttattcagagtttgaaaagctgctagccctg
caatatttagatggtgaagactacttagccaatttagctaaacaattgcagaaaagcact
ggtgtttgtgaggctgatttatggattgacggcttttttggttttactcctcaagagcag
gaagcggtgctgcaatgtatgcggtattgtcgcagtgtgacgataaccttatgcttggat
cgcgcttattcggttggtgagcggccagatgaattgaatttatttcatcccacggccgtt
actatggtgcggctgcaggagcagctagaagctttagggatgtttaccaatgaagttgta
gttcttggtgagaacgagctgccgcgtttcaggaagagccccatgctggcacatttggag
cgtaattatgagcagcgtctatctccgcgaaggaagcattatccagctgtagctgaggaa
gctctaaatgaatctattcatttgtatgcagctgtacatcgcagagcagaagtagaagga
gcagctcgagaaatacgccgtgttgtgcgagagaagcatttaagatggagagatattgca
gttcgggttaggaacattgaagcttatggagacttactagcttccgtatttgatgactat
agtattccgtacttctttgatcagaagagtacgatgatgttccatccgctagttgaattt
ataaggtcagcgctcgaggttgtcttgcataattggcaatcggatgctgtttttcgttgt
gtaaaaacggattttttattgccgctaaataaagaatcatctggcattgtagatcgtaaa
gctatggatgagcttgaaaattacgtgctagcatatggaattcaaggctatcgctggcta
gaagcgaagagctgggaaattcgacgattcaattcgttagaggatgaggaagcaacagct
aaagatgaggatacattggccttgaagcggatccaagccagcagccaattgattattaag
cctctatcccagctgcagcaacggatgaaacagtcagagactttgcagcaacggacggaa
gctttatatacaatgctcagcgattctggagttccagaaagattgcagcaatggggagat
gaagctttagctgcaggtaatccgcaaaaagcacgtgaacatagccaggtctgggatcat
gtgatgaatatgctggatcagatggtggaaatgatgggggctgaagaggtttctctagag
ctttttgtccaattattagatgccggattagaaagcattcgtttggctcttgtcccacct
tcactagatcaaatcttaattggaagcattgatcgaactcgtacagcccaggttaagatc
gcttttgtcttaggtgtgaatgatggggttctaccccaaagaatgaatgaagatggcttg
atctctgagaatgaacgcgagcttttatcggagctgggcttacatttggcggatggaagt
cgtcgcaagcttttggatgaacaatttttaatttataccgttttgtgtgcaccttcggat
tatttgtggttaagttatccgttggctgatgaggagggaaaatctttattgccctctgaa
atcatcaagcaagtgaaatcattattcccactaatgcaggaacgcttacttttagccgga
cctgaaggatcattatcggagcaagcgcaaatgagctttatcgctcagccggaacgggct
ttatcatatttaaccgtacagatgaagttggcgctgcgtggagctgagattgccccatta
tggtggcatatctataattggtttgccgttcaagcagattggcgggataagctgcagcgc
atgatgcgatcgttgctgtttactaattctgaaccagctttagccgaaacaacgcgagta
cagttatatggagatcatttaagggccagtgtttcacgcatggagcgcttcgtggcatgt
ccattttcacagtttgtctctcatggcttgcgcttgcaggaacgacggatttatcgctta
gaagcgccagatatcgggcaattatatcacgcagctttaaatgcattagtcaaagatatg
cagcaggaaggcgttctttggggaatgctgagcttggagcaattaacggaaagggcatcg
ttgatcattgatcggttgacccctaggctgcaaagcgaaatcctattaagctctgcgaga
taccgctatattgcctttaaattaaaaaatattattggtcgagcagccgtaatgttagca
gagcatgttagacgaggagcttttgtacctgttgagctagagcttggttttggaccgggg
caaacattgcctgccttaagctttcaattaaataatggctttgccatggatattattgga
cggattgaccgtgtggatcgtgcagagggtgcagagggtgcattattaaggattattgac
tataaatcaagctcaacctctttaaaattagctgaagtatatcatggactttccttgcaa
atgctgacttatctggatgtggtcatcacacatgctgaacgatggattggacagaaagca
attccggcaggcgtgctttattttcatgtgcataacccaatgattcaaagcaaaaatgca
ctgcaaagcgaagaagtggaaaaagagctgaagaaacgttttaaaacacgtggacttgta
ttggctgaaacagaagccattggattcatggatcatgacctaagtggaggaagcgggcgt
tcaagtattatcccggttgctttgaaaaatgatggaagcttctataaaaatgcatccgta
gctacacgagcagagtggagcttgctgcaaagccatgtaaggcaaactattcgtgtaatc
ggaacaaggatcacaaatggtgaggtatccgtagaaccttatcgaatgggcgagcagatt
gcttgcaccttttgtaattataaatcaatttgtgaatttgaccccttattcgcaggaaat
gactatcggataattcagcctcgaagcaatgagcaggtatggcaagcaatggcgcttgat
attgctggtgaatccgtaatggacattccactgaagcagaaaggagtgcagtag

DBGET integrated database retrieval system