KEGG   Paenibacillus psychroresistens: EHS13_12900
Entry
EHS13_12900       CDS       T06328                                 

Gene name
addA
Definition
(GenBank) helicase-exonuclease AddAB subunit AddA
  KO
K16898  ATP-dependent helicase/nuclease subunit A [EC:3.1.-.- 3.6.4.12]
Organism
ppsc  Paenibacillus psychroresistens
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_12900 (addA)
Enzymes [BR:ppsc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     EHS13_12900 (addA)
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     EHS13_12900 (addA)
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    AddAB pathway proteins
     EHS13_12900 (addA)
SSDB
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 PDDEXK_1 DEAD AAA_30 AAA_12 AAA_16
Other DBs
NCBI-ProteinID: QGR00068
UniProt: A0A6B8RVX0
LinkDB
Position
2892075..2895986
AA seq 1303 aa
MDQASKPIDSTWTDDQWEAISLRGSNILVAAAAGSGKTAVLVERIIRQISDVHNPLDVDR
LLVATFTKAAAAEMRHRIGEALEKALFAQPESQHLRRQLALIHRASITTLHSFCMEVIQR
YFQMVQLDPGFRIANETEAALLRHDQLQDLLEECYGENLDEQVNGFWLLVEWFSGERNDD
ALMALIEQLYDSSRSHPDPAKWLLEKAARFNSGANGSSEDEEPWLRSLTHDVHLELNGVE
GLLLEAIRIVEQPGGPLPYMDNLEGELSLIRYLQELSAETNQKTWHQIWGDLYEAFQTTG
FGRLNPCKGDTYDKGLQENVKQLRDRAKDQFSKLKVELFGRSLEQFSAELTEMAPLMQVL
VDLVLRFGERYMQAKIAKGLLDFADLEHYCLQILRDPASTGDELLPSRAALDYQEQFVEV
LLDEYQDTNRVQEAIIDLISRKNPGNRFIVGDVKQSIYRFRLAEPGLFLEKYKSYQKTLG
GAGRRIDLAANFRSRREVVDGVNYIFKQVMNESVGEVAYDRSAELVYGAGYPESEAGIKE
LSAEEKFAIELLLIDRSGESSESSEDDAESQEGGKSSDAEEDEGPTAGGTVRDDTQELKT
AEMEARLIALHIRRLMGMDGQPAFQVWDKKAGGMRPIAYRDIVILLRATRNWAPTLMEEL
RLQTIPAYADLNTGYFTAMEIEVVISLLQIIDNPMQDIPLAAVLRSPIVGLTADELATIR
LAQKQGSFYLALLQYVEQIGTSETAEQTLSEKLISFIATLEVWREDAKQGALADLIWGIY
RTTGFYDFVGGMPGGVQRQANLRALYDRARQYEATSFRGLFRFLRFIERMQDSGGDLGTA
RALGEQEDVVRIISIHKSKGLEFPVVFVAGLAKMFNQQDLNSTFLLHKELGFGPKYVDTK
LRVSYPSLPYLAIRRRMRLEMLAEEMRVLYVAMTRAREKLYLVGTVRNLDKQLLQWGRQL
PHKAIELPDYELAKARCYLDWIGPSLIRHPHAESLRVRGGFEKQSSNGTLLNEMPSHWKV
VLAQPELFVAQAAAASEAVVEQQQHKEALLNLTPIPLVADELSSEIEERLSWKYSYEMAS
QLLSKTSVTELKRLGDSQGSAEFSEETRSADRRLSFRRPRFIEQQQLNAAERGTVYHAVM
QQLPINAGLTLADIQGTLDRMLGLQMITSMQYNSVDVKVIHGFFGTDLGHRLLNAKQVLR
ETPFSYGLQASEIYPFAPEAIQDEMVLIQGVIDCLFEDEQGLILLDYKTDAVRTPDIPLL
AEKYRVQLELYAKAVEQIWKKPVTQTYLFYFDGAHLIELTAKR
NT seq 3912 nt   +upstreamnt  +downstreamnt
atggatcaagcctcaaaaccaatagatagcacttggacggacgatcagtgggaagcgatc
tctttgcgcggcagcaatattctcgtcgcagcagcagcgggctcaggtaaaacggccgtt
ttggtcgaacgtatcattcgccaaatatcggatgtccataatccgcttgacgtcgatcgt
ctgctagtcgcaacattcactaaggcagcggcagcagaaatgcggcatcggattggagaa
gctctagagaaagctttatttgcccaaccggaatcgcagcatctacgtcgtcaattagca
ctcattcaccgtgcatccattacaaccttgcactccttttgcatggaggtgatccagcgc
tattttcaaatggttcagctggatcctggcttcagaatcgcgaatgagacagaagcggct
ttgctgcggcacgatcagctacaggatttgctcgaggagtgctacggtgaaaacttggat
gaacaagtaaatgggttttggttgctggttgaatggtttagcggagagcgtaatgatgat
gctttaatggctttgattgaacaactctatgattcctcgagaagccaccctgatcctgct
aaatggttgctggaaaaagcagcccgttttaatagtggggcgaacggaagctctgaagat
gaggaaccgtggcttcgcagtttaactcatgatgtccatctggagttaaatggagtagaa
ggcttattgcttgaagctattcggatagtagagcagcctggaggtccgttgccttatatg
gacaatctagaaggtgaacttagtcttattcgttatttgcaggagctgtcagctgaaaca
aatcaaaaaacatggcatcaaatatggggagatttgtacgaggcttttcaaacaactggc
tttggacgtctaaatccttgcaaaggcgacacttatgacaaaggattacaagagaatgtg
aagcagctgcgggacagagcaaaagatcagtttagtaagctcaaggtagagctgtttgga
cgctctttagaacaattttcggctgaattaaccgaaatggcacctttgatgcaagtttta
gtagatttagtgttacgttttggagaacgctatatgcaggccaaaatagctaaggggttg
ctggattttgctgatttagagcattattgcttgcaaattttacgtgatccggctagcaca
ggcgatgaattattgccatctcgtgcagctctagactatcaagagcagtttgtcgaagtg
ctgctggatgaatatcaggataccaatcgcgtacaagaagctattattgatctcatttcc
cgtaaaaatccagggaacaggttcattgttggggacgtcaaacaaagcatttaccgcttt
cgtttggcggagccagggctttttctagagaaatataaaagctatcaaaagacgcttggc
ggtgctggcagaagaattgatttggcagctaattttcgcagtcgacgtgaagtggtggac
ggggttaattatatttttaaacaggtaatgaatgaatctgttggagaagttgcttatgat
cgcagtgctgagttagtttatggtgcaggttatcccgagagtgaagcaggtattaaagag
ctaagtgctgaagaaaagtttgcaattgagctgttgttaattgatagatctggagagtct
tctgaatcgagcgaggatgatgcagaatctcaagagggtggtaagtcctcggatgccgaa
gaagatgaggggccaactgcaggtggtactgtacgcgatgatacacaagaactgaaaact
gctgaaatggaagcccgcttaattgccctgcatattcggcggcttatgggaatggatggt
caacccgcttttcaggtttgggataagaaagcaggcgggatgaggccgattgcttatcga
gatatcgttattttgctgcgtgctacaaggaattgggctcctactctgatggaagaattg
cggttgcaaactatccctgcttatgcagatttgaatacgggctattttacagctatggaa
attgaagttgtgatatccctgctgcagattatcgacaaccccatgcaggatattcctttg
gctgctgtactgcgttcgccgattgttggattgactgcggatgagcttgcaacaattcgc
ttggcacagaaacaggggagcttttatctagctcttctacagtatgtagagcagattggc
acttccgaaacagctgagcaaaccttaagtgaaaagcttatttcttttatagcaacactt
gaagtctggcgagaggatgctaaacaaggcgcgctagcggatttaatttgggggatttac
cgcactacaggattttatgatttcgtcggtggaatgcctggaggagtgcagcgccaagcc
aatttaagagccttgtacgatcgtgctcggcaatatgaagctacttcctttcgcggattg
tttcgtttcttgcgttttatcgaacggatgcaggacagtggtggagatttaggaacagca
agagctttgggtgaacaagaggatgtggtgagaatcatatcgattcataaaagcaaaggt
ttggagtttccagtcgtctttgttgcaggtttagcaaaaatgttcaatcagcaggattta
aacagtacatttttgctccataaagagcttggatttggtcccaaatatgtggacaccaag
ctgcgtgtcagttatccatcattgccttatttggctattcgccggaggatgcgtttggag
atgctggctgaagaaatgcgtgtgctttatgttgcaatgacacgtgctcgggagaagctc
tacttggttggaactgttcgtaatttggacaagcaattactgcaatggggacgtcaattg
ccccataaagctattgagttaccagactatgagctagcgaaagctcgttgttatttggat
tggattggaccttccttgattcgccatcctcatgcagaatcacttcgtgtcagaggtggg
tttgaaaagcagtcaagcaatggaaccttgttgaacgaaatgccttctcattggaaagta
gtcctggcacagccagaattattcgttgcacaagctgctgcggcaagtgaagctgtggtc
gagcagcaacagcataaagaggcgttgcttaatcttactccgattccattggtagcagat
gagcttagttcagagattgaagagcggttatcttggaagtattcttatgaaatggcttcg
caattgctttccaaaacatcggtaacggagctaaagcgcttaggcgattctcaaggttct
gcagaattcagtgaggaaactcgttcagctgatcgccgcttgtcattccgccgtccacgg
tttattgaacagcagcagttgaatgctgccgagcgagggaccgtatatcatgctgtaatg
cagcagcttccgattaatgcaggattaacactagctgatattcaaggtaccttagaccgg
atgctggggcttcaaatgattacgtccatgcaatataattctgtagatgtgaaagtaatc
catggattttttggtacagatctaggtcatagattacttaatgctaagcaagttttaaga
gaaaccccttttagctatggtttgcaggctagtgaaatttacccttttgctcctgaagca
attcaggatgaaatggttttgattcaaggtgttattgattgtttgtttgaggatgaacaa
ggtttaattctcttggattataaaaccgatgctgtccgtacaccagatatcccgctttta
gcagagaagtatcgggtacagcttgagctgtacgctaaagcggttgaacagatatggaaa
aagccggtgacacaaacctatttattttatttcgatggtgctcatttgattgaattgact
gcgaagagatga

DBGET integrated database retrieval system