KEGG   Paenibacillus psychroresistens: EHS13_12910
Entry
EHS13_12910       CDS       T06328                                 

Definition
(GenBank) exonuclease SbcCD subunit D
  KO
K03547  DNA repair protein SbcD/Mre11
Organism
ppsc  Paenibacillus psychroresistens
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_12910
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     EHS13_12910
SSDB
Motif
Pfam: Metallophos Metallophos_2 SbcD_C DUF2379
Other DBs
NCBI-ProteinID: QGQ95716
UniProt: A0A6B8RJY4
LinkDB
Position
2897476..2898687
AA seq 403 aa
MRILHTADWHLGRTLEGRSRQEEQEAFMDELVTIVRDQQIDVVLMAGDAYDSVNPPAAAE
TLFYDGLARLADGGRRQVIAIAGNHDNPERLAASAPLALRQGITLVGLPTPQLQRVDVPR
TSEQALLFALPYPSESRLRELLTEEADEVSLRGAYSQRIAQLVARQASEFTSRTVNLIMS
HLYVLGGTESESERPIQVGGAYTVDTAALCANAQYVALGHLHRPQQLKASSLIRYSGSPL
AYSFSEAGQAKSVTILDVKPGDEPQLTEVFLSSGRPLVKWKAVEGIAQVHRWLEEGKDAR
AWIDLELHIVDSMSMEQIQRLRKQHVGIINIRPIYPQAAADKGVGEASRRDQLPIDEMFR
SFYTRQTGGAEADPALVSLFLELLQQTTESESVNSLSEGGNGL
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgcggattttacataccgcggattggcatttagggcggaccttggaagggcgcagcaga
caggaagaacaagaggctttcatggacgagctagtaacaattgtgagggatcagcagatt
gacgttgtcctcatggcaggtgatgcctatgattctgtcaatccaccggcagcggcggag
acgctcttctatgacgggctagcacgtctcgctgatggaggcaggcgccaggttatcgcg
attgctggcaatcacgataaccccgagcgcctagccgcctccgcaccactcgcgctgcgc
caaggcatcacgctcgtcgggctgccgacgccgcagctgcaacgcgtggacgtgcctcgc
acgagtgaacaggcgctgctttttgccctcccgtacccgtcagagtcacggctgcgcgag
ctgcttacggaggaggccgatgaggtcagcctgcgaggtgcttattcacagcgcatcgct
cagcttgtggcccgccaagccagcgaattcacctcgcgcacggtaaatctaatcatgagc
cacctctacgtattaggtgggactgaaagtgaatctgagcgccccattcaagtgggtggc
gcgtacaccgtagacacggctgcgctttgcgcaaacgcacaatatgttgcgctcggccat
ttgcatcgcccgcagcagctcaaggcaagctcgcttattcgttattcaggctcaccgcta
gcctatagcttctcagaagcgggacaagccaaatcagtaacgatattggatgtaaagcct
ggagatgaaccgcagcttacggaagtgttcttaagcagtggaagaccgctagtgaaatgg
aaagcggtcgaaggaattgcccaagtgcatcgctggcttgaagagggcaaggatgcgcgt
gcttggattgatttggagctgcatattgttgactccatgtcgatggaacaaattcaacgt
ttgcgcaagcagcacgtcgggatcattaacattcgccccatttatccgcaagcagcagct
gacaaaggagtgggagaagcaagtcgacgtgatcagcttccgatagatgaaatgtttcgg
agtttttataccagacaaactggtggagctgaggcggatcctgccttggtaagcttattt
cttgagctccttcagcaaacgacggaatcagaatccgtaaattccttgtccgaaggggga
aatggcttatga

DBGET integrated database retrieval system