KEGG   Paenibacillus psychroresistens: EHS13_12915
Entry
EHS13_12915       CDS       T06328                                 

Definition
(GenBank) SMC family ATPase
  KO
K03546  DNA repair protein SbcC/Rad50
Organism
ppsc  Paenibacillus psychroresistens
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_12915
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     EHS13_12915
SSDB
Motif
Pfam: AAA_23 SbcCD_C SMC_N AAA_21 AAA_29 ABC_tran MMR_HSR1 RNA_helicase AAA_22
Other DBs
NCBI-ProteinID: QGQ95717
UniProt: A0A6B8RIK4
LinkDB
Position
2898684..2902136
AA seq 1150 aa
MKPIQLTWAGLQSYREKQEIDFTLLCDAGVFGIFGPTGSGKSTILDAITLALYGKVERAS
NGTQGILNQYENNLSVSFTFELSHAEGSKKYRVERQFKRAADVSVTNTICRLIHIQAEQE
SIVIADKAGEVNAQIHQILGLSMQDFSRAVILPQGKFAEFLSLKGSDRRQMLQRLFHLEH
YGDVLTAKVSQRTKETDISIKQILAEQQGLGDASEQALQSTKLLLEEADNTAKQKRIELQ
QVLQLWEEIKQTRALQQTQQELEANKFSLLIEEPRIVEQEQQLKLADQAERVRHFLQQFE
DTDRLAKKLILEQDEIAKQHIEVTNQTESIVQQHILAKSELSLQDAPLQVKLEQLKQAVR
LEQEIEKGLLQENELADKLELCKAQMVLYQEELLKKQDTHTRAIKKRDDLQEQLKSLEIK
SEYRQNLQNALRDKHALDSTESKVIELEQQMSTKQQQLNTEKLREAEVTSLLKNNQAGLT
TLMHAIKRNTFNHLQTEADLEALKINTTSAIEKIKSTAKSAEIAHYALHLADQLKELQPC
PVCGSTEHPTPIKELNRESASMITSETELERHDLLLTKVLKLQFNQERQAMQYQALEQKL
VESLAFTNNGETAEAEVAAAMPLTNQTPEVLDSIELLEMEHERLSEQQILAAQQITQISD
ELKIALQKKDRIMQHQIEISAQIQAIQTMYVTLEEQLLNSKSSHKQLLEQWQSVYTSFTL
ENIQLETSKLNQQDLAAEQLRVRVEQSIPFIEENLKETQQKIIQVAELEKSKIQLETEHR
GSQRLNLELKNQFMSRWEQEIKAGESIAGYIQETELLLKKLRESEQVAQQLMEKSQNELM
RINDKYITVRQAVDSAKMAFIKAEQFWQEALARTEFVTADDVKNAYLTSNQMEVWQQEVK
KHREQIASITAKLAELIIKLNGKSVSETVCLDSELMVAAAKEMDEKALQDRAKIERDLEQ
LQSKHMHWKELEQNLSKLKQEFADLSKLQSVLRGNAFVEYIAEEQLIQVCRIASQRLGQL
TRQRYALEVDSSGGFVIRDDANGGVRRPVSTLSGGETFLTSLALALALSAQIQLSGQYPL
EFFFLDEGFGTLDPELLETVVEALEKLHIDSLTVGIISHVPELRSRLPRKLIVESAEPGG
RGSRVYMEGL
NT seq 3453 nt   +upstreamnt  +downstreamnt
atgaaaccgattcaactgacttgggctgggttgcaaagctatcgcgagaagcaggaaatt
gattttacacttctgtgtgatgcaggagtttttgggatatttggtccaacaggcagcgga
aagtcgacgattttggatgcaattacattagctttgtacggtaaagtagaacgtgcaagc
aatgggacgcaaggtattctcaatcaatatgagaataacctttctgtgagctttaccttt
gaattgtcgcatgccgaaggttccaagaaatatcgggtggagcgtcaatttaagcgagca
gctgatgtatctgtgacgaatactatctgtcgattgatacatatccaagctgagcaagaa
agcatagttatagctgataaggctggcgaagtaaatgctcaaattcaccaaattttaggg
ctttcgatgcaagatttctcgcgtgcagtgatacttcctcagggcaagtttgctgaattc
ctctcactgaaaggcagcgaccgtcgacaaatgctgcagcgcctgtttcatttagaacat
tacggtgatgtgttaacagccaaagtgagccagagaaccaaagaaacggatatatcgatt
aaacaaattttagccgagcaacaagggcttggtgatgcctcagagcaagcattacaatcg
actaagctgctattagaggaagcggacaatacggcgaagcagaaacggattgagctgcag
caagtattgcagctatgggaagaaatcaaacaaacccgagctttgcagcaaacgcagcaa
gagcttgaagctaataaattcagcctgcttattgaagaaccaagaatagttgagcaagag
cagcagttgaagttagctgatcaggcagaacgagtcaggcattttttacagcagtttgaa
gatacggatagactagcaaagaagcttatccttgaacaagatgaaatagctaagcagcac
attgaggtcacaaaccagaccgaaagcattgttcagcagcatattcttgccaagagcgag
ctatctcttcaggacgcacctctgcaggttaagttagagcagcttaagcaggctgtccgt
ttggaacaggaaatcgaaaaggggcttttacaagaaaatgagctagcagataagcttgag
ctttgcaaagctcagatggtgctttaccaggaagaattgctaaaaaaacaagatacccat
actcgagcaatcaaaaaacgagatgatctacaggagcagctaaagtcattagagatcaaa
tcggaataccgtcaaaacctgcaaaatgcgctacgcgataagcatgcattggattcaacc
gaatccaaagtaatagagcttgagcagcaaatgagtactaaacaacagcagctaaataca
gaaaaattgcgtgaagctgaagtaacttcattgttgaaaaacaatcaagcaggtttaact
acattaatgcatgctattaaaagaaatacattcaaccatttgcaaacagaggcagatttg
gaagccttaaaaataaacacgacaagtgccattgaaaaaataaaaagcacagcaaaatct
gctgaaatagcgcattatgctttgcatttagctgatcagcttaaggagctgcagccatgc
ccggtgtgtggatcaacagagcatccaacacctattaaggaattaaatagggaatcagct
tctatgattactagcgagactgagctagaacgtcatgatttgttgctaactaaagtatta
aagcttcagttcaatcaagaaagacaagctatgcagtatcaagcactagagcagaagcta
gtagaatcactcgcttttactaacaatggggaaactgcagaggctgaggttgctgcagcc
atgcccttaactaatcaaactccagaagtattggactctattgagctgctcgaaatggag
catgaacgtttatccgaacagcagatactagccgctcaacaaatcacccagatttcagat
gagttgaagatagctctgcagaaaaaagatcgcatcatgcagcatcaaatagagatttct
gcacaaatacaagctattcaaacgatgtacgtaactttagaggagcaattactcaattct
aaaagctcgcacaaacaattattggagcaatggcaatcggtatatacgtcatttacgctt
gagaacattcagttagaaactagcaagttaaatcaacaggatctggccgcggaacaattg
cgcgtacgggtggagcaaagtattccttttattgaagagaatttaaaagaaacacaacaa
aaaataatacaagtcgcagagctcgaaaaatcgaagattcaattagagaccgagcataga
ggctcgcaaaggttgaatttggaactgaaaaatcaatttatgtcccgttgggagcaagaa
ataaaagctggggaatctatagcagggtacattcaagaaacggaattactcttgaaaaag
cttcgtgaatcggagcaggtagcccagcagctaatggaaaaatcgcaaaatgaactgatg
cggataaacgacaaatatataaccgttcgccaagcagttgattcagctaagatggctttt
attaaagcggagcagttttggcaggaagctctagcgagaactgaattcgttactgcagat
gatgtgaaaaatgcgtatttgactagtaatcaaatggaagtttggcagcaagaagtgaaa
aaacatcgcgagcaaatagctagtataactgcaaagctcgcagaactgataattaagcta
aacggaaagtcagttagtgaaacggtatgcttggattcggagttaatggtggccgcagct
aaggaaatggacgaaaaagccttacaggatcgtgccaaaatcgaacgagatctcgagcag
ctgcaatccaagcacatgcattggaaggaattggaacaaaatttaagtaagctgaaacaa
gaatttgctgatttaagcaagctgcaaagtgtgctgcgtggaaatgcttttgttgagtat
attgcagaagaacaattgatccaggtatgtcggattgcttcacaaagactagggcagtta
accagacagcgatatgcgttagaggttgattcatctggtgggtttgtcattcgagatgat
gctaatggaggagttagaagaccggtaagtactttgtctggcggagaaacctttttaaca
tcgttagctttagcattggctctgtctgcacaaatccaattgagcggccagtatcctttg
gaattcttttttctagacgagggattcggaacacttgatcctgagttgttggaaacggtt
gtcgaagcattagaaaagctccatatagacagccttacagtgggtatcattagtcatgta
cctgagctgagatcacggcttccccgcaagctaattgttgaatctgctgaacctggaggt
agaggaagtcgagtatatatggaaggcttataa

DBGET integrated database retrieval system