KEGG   Paenibacillus psychroresistens: EHS13_12985
Entry
EHS13_12985       CDS       T06328                                 

Gene name
recO
Definition
(GenBank) DNA repair protein RecO
  KO
K03584  DNA repair protein RecO (recombination protein O)
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    EHS13_12985 (recO)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_12985 (recO)
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     EHS13_12985 (recO)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      EHS13_12985 (recO)
SSDB
Motif
Pfam: RecO_C RecO_N RecO_N_2
Other DBs
NCBI-ProteinID: QGQ95731
UniProt: A0A6B8RGZ0
LinkDB
Position
2914818..2915564
AA seq 248 aa
MLYKLEGIVIRSMDYGENNKIIAIYTRHNGKMSIMVRGAKKMNSRFSSVTQIFTHGEFVL
FKTSSMGTLNQSETLESHRKLRENLHMSAYSAYVVELIDRIVPELDANEMMFEQLKASLE
AIESNKDPAIVLNIMEMKMLAIAGYLPQLDECVSCNAHDGEMGISITQGGVLCAKCFYKD
NQLFRISASTLKMLRLFQRMDLRRLGAIEVKDETKKQLKLIMRAFMDHFIDIRLKARGFL
DQMDKYEL
NT seq 747 nt   +upstreamnt  +downstreamnt
gtgctctacaagctggaaggcattgtcattcgaagtatggattatggagaaaacaataag
attatagctatttatacacgccataacggtaaaatgagtattatggtacgaggcgccaag
aaaatgaacagccgtttttcgtctgtaacacaaatatttacacatggtgaatttgttttg
ttcaaaaccagctctatgggaactttaaatcaaagtgaaactcttgaatcgcatcgtaag
cttcgtgagaatttgcatatgtccgcttattctgcctatgttgttgaacttattgaccgt
attgtaccggagttagatgcgaacgaaatgatgtttgaacaactcaaagccagtctcgaa
gccatagaatccaataaggatccagctattgtgctgaacattatggaaatgaaaatgtta
gctattgccggatacctgcctcaattggatgaatgtgttagctgcaatgctcatgatgga
gaaatggggatcagcattacgcaaggtggcgtactttgcgctaaatgtttttataaagac
aatcagctttttcggatatcagcgtcaaccttaaaaatgctgcgattatttcaacgtatg
gaccttcgcagactaggtgcaattgaagtcaaagatgaaacaaaaaaacaattaaagctt
attatgcgcgcttttatggatcattttatcgatattcgtttgaaagctcgtgggtttcta
gatcaaatggataaatatgagctatag

DBGET integrated database retrieval system