KEGG   Paenibacillus psychroresistens: EHS13_13010
Entry
EHS13_13010       CDS       T06328                                 

Definition
(GenBank) DNA primase
  KO
K02316  DNA primase [EC:2.7.7.101]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03030  DNA replication
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    EHS13_13010
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ppsc03032]
    EHS13_13010
Enzymes [BR:ppsc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.101  DNA primase DnaG
     EHS13_13010
DNA replication proteins [BR:ppsc03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    EHS13_13010
SSDB
Motif
Pfam: Toprim_N zf-CHC2 Toprim_2 Toprim_4 Toprim_3 DnaB_bind Toprim DnaB TPP_enzyme_C
Other DBs
NCBI-ProteinID: QGQ95736
UniProt: A0A6B8RK01
LinkDB
Position
2920232..2922061
AA seq 609 aa
MSNGRIPDSIIEAVLKHHDIVDVVGKFVHLSKQGRYMKGLCPFHSEKSPSFTVTPEKQIF
YCYGCHMGGNAINFVKEMEGLSYGEAVRQMAEEANISIGWETPTEQQTELQLDKAKLLQA
YELSTKLYHHVLLNTVQGKEAMQYLRMRGLTDKWIEFFQIGYAPPAWDTLAQFLEKRQFL
LPLMEQGGLLSARSSGGYVDKFRDRILFPICDVKGRVIAFGGRAMGDVQPKYMNSPESVL
FNKSSSLYNFHQARAVIRKNRQVVLFEGYVDVIKAWEAGVTNGVATMGTALTEEHAAHLK
RNADEVVVCYDGDNAGQTAAFKSIATLEKAQLHVKIAMLPEGLDPDEYIGKHGAESFQRE
VIESAVPTIKYKLIFERKRFNLLQQDGKRQYLDVAIRMIAELPSAIDREQYSKELSVDYQ
LTLDTIKQEMNEHRQEFLKKQQTGDNKHHSWNNDMNIGRVSKKDAPLLEAHQVAEKKLLS
AMIHDSEIATYVQQRLDEQFNVEAHAALAAYLYAYYAQGNAPDASRYIATLQDEQLESVA
SSILMLEGNEANNAQAIDDYIRVILHYPQLQALEQRSQEALRAQNAGDYALAAQIHKEIS
TLKQQLKSF
NT seq 1830 nt   +upstreamnt  +downstreamnt
atgagtaacggacgtattcccgattcgattatcgaggcagttcttaagcatcatgacatt
gtagatgtcgttggtaaatttgtacacttgagtaaacaagggcgctatatgaaaggacta
tgtccttttcattcggagaaatctccttcctttaccgttactccagaaaaacaaattttt
tattgctacggttgccatatgggtggaaatgcgattaattttgtgaaggaaatggaaggc
ctgtcttacggagaagctgttcgtcaaatggcggaggaagctaatatctcgattggctgg
gaaacacccactgagcaacaaaccgagctacagttagacaaagctaagttattacaggct
tatgagctttctaccaagctgtatcatcatgttctactcaatacggtgcaaggcaaagaa
gccatgcaatatctgcgtatgagagggctaactgataaatggattgaattttttcaaatt
ggatatgcgccacctgcttgggacactctagctcaatttctcgaaaagcggcaattttta
ctaccgttaatggagcaaggaggactgcttagcgctaggtcatctggcggctatgtcgat
aaatttcgtgatcgaatcctatttccaatatgtgatgtaaagggaagggtgattgctttt
ggtggacgtgcaatgggagatgttcagcccaaatacatgaatagtcctgagtccgtgctg
tttaataaaagcagcagcttatacaacttccatcaagcaagagcagtgatccgcaagaat
cgccaggttgtattattcgaaggatatgtggatgtcattaaagcatgggaggccggagta
actaacggtgttgctacaatgggaactgcattaaccgaagagcatgcagcacatttgaaa
agaaatgcagatgaagtagtcgtttgctacgatggtgacaacgccggacagacagcagcc
ttcaaaagtatcgcgactctggaaaaagcacagctgcatgtcaaaatcgccatgttaccg
gaaggcttggatccggatgaatacattggcaaacatggcgcagaaagctttcaaagagaa
gtaatcgaatctgctgtacccacgattaaatacaaattgatttttgaacgcaaaagattc
aatttgctccagcaggacggaaaacgccagtatctggatgttgctattcgaatgattgca
gagcttccttccgcgattgatcgtgaacagtactctaaggaattgtcagtggattatcag
ctgacacttgacacgattaaacaagaaatgaatgaacatcggcaagaatttctaaaaaag
caacaaacgggggataataagcatcattcgtggaataatgatatgaatattggaagagtt
tcgaaaaaagatgctcctttactggaggctcatcaggttgctgagaaaaagctattgtct
gcaatgatccatgattcggagattgccacatatgtacagcagcgtttagatgaacagttt
aatgtggaagctcacgcagctcttgctgcttatttatacgcctattacgcccaagggaac
gcaccggatgcaagtcgatacatcgcaaccttacaggatgagcaattggaaagtgtcgcc
agctcgatattaatgctggaaggcaatgaagccaacaatgctcaagcaatcgatgattat
attcgtgtcattctgcattatccgcagctacaggcattggagcaaagaagtcaagaagca
ttacgtgcccagaacgcgggtgactatgcattagcagcacagattcacaaggaaattagt
accttaaaacaacagctgaaatcgttttag

DBGET integrated database retrieval system