KEGG   Paenibacillus psychroresistens: EHS13_13475
Entry
EHS13_13475       CDS       T06328                                 

Definition
(GenBank) (deoxy)nucleoside triphosphate pyrophosphohydrolase
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
ppsc  Paenibacillus psychroresistens
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_13475
Enzymes [BR:ppsc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     EHS13_13475
DNA repair and recombination proteins [BR:ppsc03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    EHS13_13475
 Prokaryotic type
    EHS13_13475
SSDB
Motif
Pfam: NUDIX NUDIX_4 NUDIX_2 HHH_2
Other DBs
NCBI-ProteinID: QGQ95814
UniProt: A0A6B8RJA4
LinkDB
Position
3015788..3016174
AA seq 128 aa
MKQIDVVAAVILNEQNEVLCALRSVTMSLPGLWEFPGGKIEQGEDPHTALIREVKEELRC
VIEVGEKITETVHEYPAIKVRLISYFAKVISGIPQVTEHESLVYQKKNELLLLEWAPADI
PTVQILIG
NT seq 387 nt   +upstreamnt  +downstreamnt
atgaaacaaattgatgtggttgctgcagtaatcctaaatgaacagaacgaagtgttatgt
gcgctgcgctctgtaacaatgtctttacctgggctatgggaatttccgggcggtaaaata
gagcagggtgaggatccacatacagcgctaatacgggaagtaaaagaagagcttaggtgc
gttatagaagtaggggaaaagattacggagacagttcatgaatatccagcaatcaaggtt
aggcttatttcatactttgcaaaggttattagcggaattccacaagtaacggaacatgaa
agtctggtatatcaaaagaaaaatgaattgcttctacttgaatgggcaccagctgacatt
ccaaccgttcagatattaataggatag

DBGET integrated database retrieval system