KEGG   Paenibacillus psychroresistens: EHS13_13600
Entry
EHS13_13600       CDS       T06328                                 

Definition
(GenBank) SMC family ATPase
  KO
K03546  DNA repair protein SbcC/Rad50
Organism
ppsc  Paenibacillus psychroresistens
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_13600
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     EHS13_13600
SSDB
Motif
Pfam: AAA_23 SMC_N SbcCD_C Speriolin_C
Other DBs
NCBI-ProteinID: QGQ95838
UniProt: A0A6B8RKF7
LinkDB
Position
3040497..3043043
AA seq 848 aa
MIPISIELVNFRAIPYALIDLSSVTIAAICGRNGAGKSSAFTLAPIFSLFGDKIKGISMD
DLVRKGTQEMAVTFTFEHQDSIYRTIRTRSIKGNGKSTLELQQKVNEQWESRSAEKIKDT
EDIIRNLLNLDAETFTASSMILQGKANEFTAQTAGKRKEILQQVLGLNIYDQLLESARHK
SATLNIEIERAKSKLTDLNETLAVKEEKDELLAEHKQQLAETSENLNKYEADLKLLQIEV
IELQAKSTKAAELAKQSFVLFEEITLLGSERSGLVAKLDRAEKILQYETQIIEKSKEALV
VQEKITILQTKAPRSQEIQAEQVRIQAEITKIETDSIPIVGQIASLTKLIANKSILDVAA
AEFVESISSLEKLDKLQMLDQEKHSSLLVAQELSSSTRLQFENKKKALDERIRVLTGKTV
MLADSNCIDVTIAACHFLSDAQKAKAELILANDEVAKLDPIECNILENAYELLLNERKAL
DYDQMVHLKLKERVNQLRPLSEQAGQLDAKVELLTNLEAQMKRFEESKLAAEVRLHNLNE
ESGALLLELVELPDLQQKLVKIMEWAVLKDQLATSIEIRGSATERIAAIDLEVTNKTNRR
NGYDVDTSLLVLETIEFEAKKQMVPVYEQQIKAAREQQGILQVRIGGLQTELKAFEDAEA
ERKRITTYMEPLVKEWTRYQTLIKAFGKDGIPALIIENAVPALEKIANEILGKMSKGKHS
LRFETQRELKSKDGIAETLDIMIGDWSGERPYETFSGGEQLRIDFAIRFALAELLACRAG
SKVEWLTIDEGLGSQDGEHRALVLESIKAVADRFKKVLVITHIEEAQSVFDQRIYFENSD
AGINIQVA
NT seq 2547 nt   +upstreamnt  +downstreamnt
atgataccaatcagcattgaacttgttaatttccgtgctataccttatgccttgatagat
ttaagcagcgttacgattgctgcgatatgtggccgcaacggagccggaaagagctcagcc
ttcacacttgctccgattttttctctttttggagataagataaagggaataagcatggat
gaccttgttcgtaaaggtacccaagaaatggcagttacgtttactttcgaacatcaagac
agtatttatcgaaccattcgtactcggtccataaagggtaatggtaaaagcacgcttgaa
cttcagcaaaaggtaaatgaacaatgggagagtaggtcggccgagaagattaaggataca
gaggatattatccggaacttacttaatctcgatgctgaaacctttactgcttcaagcatg
attcttcaaggtaaagcaaatgagtttaccgctcagactgccggcaaacgtaaagagatt
ctgcagcaagtgctcggcttaaatatctacgatcaattgttagaaagtgcgagacataaa
tccgctactttaaatatagaaattgaaagggctaaatcgaagcttactgatttaaatgaa
acattggcagtcaaagaagaaaaggatgagctgcttgctgaacacaagcagcagctcgca
gagacaagtgaaaacttgaataaatatgaagcggatttaaagttactgcagatagaagtg
atagagctacaagcaaaatcaactaaagcagcggagcttgctaaacaatcctttgtacta
ttcgaagaaataaccctattaggttctgaacgttcaggtcttgttgccaagctagatcga
gcagagaaaatcctccagtatgaaacacaaattattgaaaaatcaaaagaagctcttgtg
gttcaagaaaaaataaccattctacaaacgaaggcgccgcgctctcaagaaatacaagca
gagcaagttcgtattcaagctgaaattactaaaattgaaacggattctattcctattgtt
ggacagattgcctcgctaacaaagttaattgcgaataaatctattcttgatgttgcagct
gcagaatttgtcgaatctatttccagtctagaaaagttggataaactgcagatgttggat
caggagaagcactcttccttattagtggcacaagagttatctagtagtacacgacttcaa
tttgaaaataaaaagaaggcacttgatgaacggattagagtattaaccggcaagacagtc
atgcttgctgattccaattgtattgacgtgacgatagcagcttgccattttctttcggat
gctcaaaaagcaaaggcagaacttattcttgctaatgacgaggtagctaaacttgatccc
atcgaatgcaatattttagagaatgcatatgaactattgttaaatgaacgtaaggctctt
gactacgatcaaatggttcatttgaagctaaaggaacgcgttaatcagcttcgtcctcta
tctgaacaagcaggtcaattggatgctaaggtggagcttttaacaaaccttgaggcacaa
atgaagaggtttgaagaatccaagctagctgcagaggttcgattgcataatctcaatgag
gaaagtggagccttgctattggagctcgttgagctgcctgatcttcaacaaaagttagtc
aagattatggaatgggctgttttaaaagatcagcttgctacctctattgaaataagagga
tcagcgactgaacgtattgcagccattgatctggaagttaccaataaaacaaatcgtcga
aatgggtatgatgttgatacttctttgcttgttttagagactatcgaatttgaagcgaag
aagcaaatggtacctgtttatgagcagcagataaaagctgctcgagagcagcagggaatt
cttcaggttcgtatcggtggattacaaacagagcttaaagcatttgaagatgctgaagct
gagcgaaaacgcattactacttacatggaacctctagtgaaggaatggactaggtaccag
acattaattaaagcatttggcaaagatggtatcccagctttaattattgaaaatgcggtg
ccggcacttgagaagattgctaacgagattcttgggaaaatgagtaagggcaaacattca
cttcgatttgagacgcagcgagaacttaaatctaaggatggcattgctgagacgctggat
attatgataggcgattggtccggagaacggccctacgagacgttttctggtggggagcag
ttacgtatcgactttgcaattaggttcgctcttgctgaattactcgcttgcagagctggc
tctaaagtggagtggttaacgattgatgaagggctgggctcgcaagatggtgagcaccgt
gcgttagttttagaatctatcaaagcagtagccgatcgctttaagaaggtgttagttatc
acacatatagaagaagcgcagtctgtatttgatcaacggatttactttgaaaactcagat
gctggcataaatattcaagtggcatga

DBGET integrated database retrieval system