KEGG   Paenibacillus psychroresistens: EHS13_13630
Entry
EHS13_13630       CDS       T06328                                 

Definition
(GenBank) hypothetical protein
  KO
K01159  crossover junction endodeoxyribonuclease RuvC [EC:3.1.22.4]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    EHS13_13630
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_13630
Enzymes [BR:ppsc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.4  crossover junction endodeoxyribonuclease
     EHS13_13630
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     EHS13_13630
    RecFOR pathway proteins
     EHS13_13630
SSDB
Motif
Pfam: RuvC
Other DBs
NCBI-ProteinID: QGQ95843
UniProt: A0A6B8RJV5
LinkDB
Position
3046391..3046945
AA seq 184 aa
MSRYVGIDPSTKTGLVVLDEAGEIWEAIEIDTGLNGQSPTSKEMKRLVVRIISYVIPGDE
VAIEGFGFSSQSGFLLGGIGWLLRVALDDIGVRYKDIAPSQLKKFTGEGGNAAKEAVAVG
VYKRWGFQSKSNNITDAFVLAQIVRAIHEPVHLIALQKEVIKQIQTPIAAKIKGKTKTNR
RKAV
NT seq 555 nt   +upstreamnt  +downstreamnt
atgagccgttatgtaggtattgatccttcaacaaagacggggttagtcgtcctggacgaa
gcaggggagatttgggaagccatcgagattgatactggcctgaatggtcaaagcccaact
tcaaaggaaatgaaacgacttgttgtcagaatcatttcatatgtcataccaggcgatgaa
gttgccattgaggggtttggcttttcgtcacaatccggtttcttgctgggcggtataggt
tggctgctgcgggttgctcttgatgatataggtgtgaggtataaagacatcgctccttca
caattgaaaaagtttacgggtgaaggtgggaatgctgcaaaagaggctgttgctgttggg
gtttataaacgatggggatttcaaagtaaaagtaataatataaccgacgcttttgtactt
gctcagattgtcagagctattcatgagccggtccatttaatcgccttgcagaaagaagtc
attaagcaaattcaaactccaattgcagctaaaataaaaggtaaaacaaaaaccaataga
cgaaaggcagtgtga

DBGET integrated database retrieval system