KEGG   Paenibacillus psychroresistens: EHS13_13640
Entry
EHS13_13640       CDS       T06328                                 

Definition
(GenBank) DNA adenine methylase
  KO
K06223  DNA adenine methylase [EC:2.1.1.72]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    EHS13_13640
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ppsc03032]
    EHS13_13640
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_13640
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:ppsc02048]
    EHS13_13640
Enzymes [BR:ppsc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.72  site-specific DNA-methyltransferase (adenine-specific)
     EHS13_13640
DNA replication proteins [BR:ppsc03032]
 Prokaryotic type
  DNA Replication Termination Factors
   DNA methylation enzymes
    EHS13_13640
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     EHS13_13640
Prokaryotic defense system [BR:ppsc02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   DNA methyltransferases
    EHS13_13640
SSDB
Motif
Pfam: MethyltransfD12
Other DBs
NCBI-ProteinID: QGQ95845
UniProt: A0A6B8RJQ1
LinkDB
Position
3048195..3048995
AA seq 266 aa
MAIPRILHYPGSKWSIADWIISHMPPHKVYLEPYFGSGAVLFNKAPSTIETINDIDGEIV
NLFTVIRNYPEEIARLIQLTPYARDEYNAAHDISDDELERARRFLVRCWQAIRPKTNSKS
GWRCRSTIRDAFHVKQWCSLPDRFGLVAERLKQVQIENVPAEELLPRYRDAEVLIFADPP
YVLSTRYDKIYKNEMSNDQHINLLNLLNEHPGPVLLTGYENQLYDDRLKHWTRREIAGKP
VMGQPRTEVLWINPVAISKIGLQLMF
NT seq 801 nt   +upstreamnt  +downstreamnt
atggcaataccgcgtatattgcattacccaggaagcaagtggagtatagctgattggatc
atatcacatatgccaccacacaaagtttacttggagccttatttcggcagcggggctgtt
ctttttaataaggccccgtcaacaatagaaactattaatgatattgatggagagattgtt
aatctttttactgtgatacgaaattatccagaagaaattgcaagattaatacaacttact
ccgtatgcacgtgatgaatacaacgcagcacatgatatttcggatgatgaattagagcgt
gcaaggcgttttttagttcgttgttggcaagcaattcgaccaaagacaaattcgaaatct
ggatggcgctgcagatcgactatacgtgatgcgtttcatgttaaacaatggtgttcatta
cctgatcgttttggtttggtagctgagaggttgaaacaggtacaaattgaaaatgttcca
gcagaggaattattgcctaggtatcgtgatgcagaagtattaatttttgcagacccaccg
tacgttctgagtacgagatacgataaaatttataaaaatgagatgtccaatgaccaacac
attaatttattaaatttattaaatgaacatccagggccggtgttgttaacaggatacgaa
aatcaactatacgatgatcggttgaaacattggactagacgagaaattgctgggaaacca
gttatgggccaacctcgcactgaggttttatggattaatccagtggctatatcgaagatc
gggctgcaattgatgttttaa

DBGET integrated database retrieval system