KEGG   Paenibacillus psychroresistens: EHS13_15270
Entry
EHS13_15270       CDS       T06328                                 

Definition
(GenBank) DNA mismatch repair protein MutS
  KO
K07456  DNA mismatch repair protein MutS2
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    EHS13_15270
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_15270
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     EHS13_15270
SSDB
Motif
Pfam: MutS_V NdhN
Other DBs
NCBI-ProteinID: QGQ96138
UniProt: A0A6B8RL90
LinkDB
Position
3445194..3447152
AA seq 652 aa
MEIETMQRLEYDKIKLRLSDFAASYLGQQHIERMQPLTDIKVIAALLSEVEEGKTLIQHG
ISVPIPALEGIEHIMSGIGKGMLFTGEELSLVGRLLESTDQLKRFMFKRETVAPIVTSYA
SSLYELKELKSEIERCIRHGQITDQASVELGKVRKKIIITEERIKKKLESTMQKYKPYLQ
EFVVSMRGNRYVLSVKKEYRKLINGAVLDESASGQTVFVEPADISMLTYELSEYRAEEAQ
EEMRVLGALADLLEGYSYELGINLETIGHYDFLFAKAKYALSMDGRSVELNKHGVIRIHG
ARHPHLGKHTIPLDFAIGEAYSALIITGPNTGGKTAALKTVGLLTLMVQSGLLVPVGKGC
SFAVYSRVEVDIGDGQSLEQSLSTFSSHIKNVIRILKCAGPSTLILLDELATGTDPGEGI
GLSIAVLEELHRRGATIVATTHFNEIKKFADAAPGFENASMEFDLETLRPLYQLTIGKAG
NSYAFYIALQLGIAPEIIERSKAITYSKGGVEGNSLISMETALQSHALTKQPQPMKAAEE
QPVTAKVAPAISFSIGDCVWIRSLKRTGIVCELADVRGDMLLLIQKEKVRINHKRLTPYI
DRKQLYPEGDYDMDIVFESKEVRKQRKQMGKRHDPKNVIHTSNANEDKGRLR
NT seq 1959 nt   +upstreamnt  +downstreamnt
atggaaatcgaaacaatgcaacgcttggaatacgacaaaattaagctaagactaagcgac
ttcgctgcctcttatctaggtcaacaacatattgagcggatgcagccattaacagatatc
aaggtcattgctgcgctgcttagtgaggtggaggaagggaaaacgctgattcagcacggc
attagcgtaccgatccccgcattagaaggcatagagcacattatgagtggaatcggcaaa
gggatgctttttacaggagaggagcttagcttggtgggcaggctgctggaaagcaccgat
cagcttaaacgatttatgtttaaaagggagaccgtagcgcccatcgtcacttcgtatgcc
tcatcactctacgagttgaaggagcttaagagtgaaattgagcgctgtattcgtcacgga
cagattacggaccaagcaagcgtggagctgggcaaggtgcggaagaagatcattattacg
gaggagcggattaagaagaagctcgagagcacgatgcagaagtataagccgtatcttcag
gagtttgtcgtcagtatgcggggaaaccgctatgtgctttccgtgaaaaaagaataccgc
aagctcataaatggagctgtgttggatgagtctgctagcggacagacggtgttcgtcgag
cctgccgatatctcaatgctgacgtatgagctcagtgaatatcgagctgaggaagcgcag
gaagaaatgagggtgctcggcgctctagctgatctactggagggttattcttatgaactg
gggattaatctggagacaatcgggcattatgattttttatttgctaaggctaaatatgcc
ttgtccatggacgggcgatctgtggagctgaataagcatggagtgattcgaattcatggt
gcgagacatcctcatctcggcaaacatacgattccgctggattttgccattggggaggcc
tatagcgctttaattattactggaccgaatacgggagggaagacggctgcgctgaaaacc
gtaggtttattgacacttatggtgcagtctggattgcttgttccggttggtaaaggctgc
agctttgccgtatattcccgtgtcgaggtcgatattggcgatggccagagcttggagcag
tcgcttagcacgttttcctcgcatattaagaacgtgattcgcattctaaaatgtgctgga
ccgtctacgttgattttgctggatgagctggctacagggactgatcctggggaagggatt
ggcttatctatcgcagttttggaagagctgcatcgtagaggagcgacaattgtggctaca
acacattttaacgagattaagaaatttgctgatgccgcgccagggtttgagaatgcaagt
atggagtttgatctggagacgctaagacctttatatcagctgaccatcgggaaagctggc
aacagctacgccttctacattgcgctgcagctggggattgcacctgagattattgagcgt
tctaaggcgattacttactccaagggtggggtggaaggcaattctttgatctcgatggaa
acggccttgcagtcgcatgcattaactaaacagccgcaaccgatgaaagcagcagaagag
cagcctgttactgcaaaggtcgctcccgctataagcttcagcattggtgactgcgtctgg
attcgttcacttaagcgcacgggaattgtctgcgagctggctgatgtgcgtggagatatg
ctgctgctcattcagaaggaaaaagtcagaatcaaccacaaacgcttgaccccgtatatc
gatagaaaacagctctatcctgagggagattacgatatggatattgtttttgagtccaag
gaagtccgtaagcaacgcaagcaaatgggaaaacggcacgatcctaagaatgtaatccac
acatcgaacgcaaatgaagataaggggagattaagatga

DBGET integrated database retrieval system