KEGG   Paenibacillus psychroresistens: EHS13_15705
Entry
EHS13_15705       CDS       T06328                                 

Gene name
topA
Definition
(GenBank) type I DNA topoisomerase
  KO
K03168  DNA topoisomerase I [EC:5.6.2.1]
Organism
ppsc  Paenibacillus psychroresistens
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ppsc03032]
    EHS13_15705 (topA)
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_15705 (topA)
Enzymes [BR:ppsc01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.1  DNA topoisomerase
     EHS13_15705 (topA)
DNA replication proteins [BR:ppsc03032]
 Prokaryotic type
  DNA Topoisomerases
   EHS13_15705 (topA)
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      EHS13_15705 (topA)
SSDB
Motif
Pfam: Topoisom_bac zf-C4_Topoisom Toprim RNA_POL_M_15KD Toprim_4 Toprim_3 DZR Auto_anti-p27
Other DBs
NCBI-ProteinID: QGQ96220
UniProt: A0A6B8RIY6
LinkDB
Position
3521623..3523719
AA seq 698 aa
MADSLVIVESPAKAKTIGKYLGSKYIVKASMGHIRDLPKSQIGVEVKNNFEPKYITIRGK
GSILKEIKDAAKRVKNVYLAADPDREGEAIAWHLAHYLDLEVGEPCRVVFNEITKQAVKD
AFKNPRPINLDLVNAQQARRILDRLVGYKISPLLWKKVKKGLSAGRVQSVTVKMIYDREH
EINEFIPEEYWSITAQLLAGTTAFEAKFHAMNKDKKELHTEAEVQVILDSILNADFLVSE
VKEKERLRNPSAPFITSTLQQEAARKLNFRAAKTMSVAQQLYEGIDLGKEGTVGLITYMR
TDSTRISPIAQEEAKEFIIQKYGPSYAPETPRVYSKKAVNAQEAHEAIRPSSVLREPDEV
KSFLTKDQHRLYKLVWERFVSSQMTSAILDTMTIDFAVGDATFRSVGSKMKFPGFMKIYV
EGNDDGTTDEDRLLPPLKEGNKVEKTDILPKQHFTQPPPRYTEARLVRALEEMGIGRPST
YAPTLETVQKRGYVALEEKKFIPTELGELVIELMIEFFPEILDVAFTAQMEEELDNVGEG
KENWVKVLETFYETFEKRLEFAEEEMKEIEIKDEVSDELCEKCEMPMVYKMGRFGKFLAC
SGFPNCRNTKPIIKDIGVTCPKCKEGHIVERRSKKGRVFFGCNLYPGCDFVSWDRPVDKP
CPQCGSMLIQKTNKSGTHIQCVECDFKEEKEDLDEAAE
NT seq 2097 nt   +upstreamnt  +downstreamnt
atggcagactcactagtcatcgtggaatcacccgctaaagcgaaaacgatcggtaaatat
ttaggcagcaaatacatcgtaaaagcatcaatgggtcatattcgtgatcttccaaaaagt
cagattggcgtcgaagtcaagaataactttgaacccaaatatattaccattcgtggtaaa
ggctcgattttgaaggaaattaaagatgcagctaaacgtgtgaagaatgtctatcttgca
gccgatccggatcgtgaaggggaagcaattgcctggcatttggcgcattacctagattta
gaagtaggcgagccttgccgagttgtttttaatgaaattacgaagcaagcagtaaaggat
gcctttaaaaacccgcgtccaatcaatttggatttggttaatgcccagcaagctagacgt
atcctagatcgtttagtgggttacaaaatcagtccattgctatggaaaaaggttaaaaag
gggctttctgcaggtcgtgttcaatccgttaccgttaaaatgatctacgatcgtgagcat
gagatcaacgagttcattccagaggaatactggtccattacagctcagcttcttgctggt
acaacggcatttgaggctaaattccatgccatgaacaaggataaaaaagaactacatacc
gaagcggaagtgcaagtaattcttgactctatccttaatgctgactttctggttagtgaa
gttaaggaaaaagaacgtttacgtaatccttcggcaccatttattacaagtaccttacag
caggaagcggcaagaaagcttaatttccgagcagctaagacgatgtctgttgctcagcag
ctttacgaagggattgaccttggcaaagaaggaacagtcggtttaattacctatatgcgt
acagattcgacgcggatttctccaattgctcaagaagaagccaaggagttcattatccag
aaatatggccctagctatgcaccggaaacaccgcgagtttattcgaaaaaagctgtaaac
gcacaagaagctcatgaagcaattcgcccgagctctgtattaagagagccagatgaagtc
aaaagctttttgaccaaggatcagcatcgcttatacaagcttgtttgggaacgctttgtt
tctagccaaatgacttccgccatcttagatacaatgaccatagattttgctgttggggat
gcaacgtttcgctctgttggttctaaaatgaaatttccaggatttatgaagatatatgtt
gaaggtaatgatgatgggactacagatgaagaccgtctgcttccgccattgaaagaaggc
aataaagttgaaaagacggatatcttaccgaagcagcattttacacagcctcctccgcgg
tatacggaagcaagattggttcgtgctttggaagaaatgggtatcggacgtccaagtacg
tatgctccaactctagaaaccgttcaaaagcgtggttatgtagctttagaggaaaagaag
tttattccaacggagctaggcgaattagttattgagctaatgatcgaattttttccggag
atcctcgatgttgcctttaccgcacagatggaagaagagctggataacgttggcgagggc
aaagaaaattgggtgaaagtgctcgaaaccttctatgaaaccttcgaaaagcgcttggaa
tttgccgaagaagaaatgaaggaaatcgagataaaagatgaagtatccgatgagctttgc
gaaaagtgcgaaatgccgatggtttacaagatgggtcgctttggcaaattcctcgcatgc
tctggtttccctaattgccgaaacacaaagccgattattaaagacattggcgttacttgc
cctaaatgtaaggaaggtcatattgtcgaacgccgcagtaaaaaaggcagagtgtttttt
ggctgtaatctttatccgggctgtgattttgtatcctgggatcgaccggtcgataagccg
tgcccgcaatgtggatccatgcttattcaaaaaaccaataagagcggtactcatattcaa
tgcgtcgagtgtgactttaaagaagaaaaagaagatttggatgaagcagcagaataa

DBGET integrated database retrieval system