KEGG   Paenibacillus psychroresistens: EHS13_15960
Entry
EHS13_15960       CDS       T06328                                 

Definition
(GenBank) PolC-type DNA polymerase III
  KO
K03763  DNA polymerase III subunit alpha, Gram-positive type [EC:2.7.7.7]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03030  DNA replication
ppsc03430  Mismatch repair
ppsc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    EHS13_15960
   03430 Mismatch repair
    EHS13_15960
   03440 Homologous recombination
    EHS13_15960
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ppsc03032]
    EHS13_15960
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_15960
Enzymes [BR:ppsc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     EHS13_15960
DNA replication proteins [BR:ppsc03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     EHS13_15960
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     EHS13_15960
SSDB
Motif
Pfam: DNA_pol3_alpha PHP RNase_T DNA_pol3_finger DNA_pol3_a_NI DNA_pol3_a_NII HHH_6 DNA_pol_A_exo1 RNase_H_2 tRNA_anti-codon HHH_3
Other DBs
NCBI-ProteinID: QGQ96267
UniProt: A0A6B8RKB6
LinkDB
Position
3568212..3572540
AA seq 1442 aa
MIKKRERFELLLQQALFSSEIINGHFAEGYIDQVEVSRSNSQWTFTLAKKQILPSDIYQI
FCKTIRDKFAHIAQIDFIVKYDLAEVSSDSLINTYWAHCSEWIKKAVPSINGYIRDAKYE
LNGDVITVSILEEIGMEIVKKKSGELWIQRYFRDFFAREFTVRFNVTESNEIELKRVQYF
QQNEQEDKMFTQNLVSAIEKDVEASKATEGELKLMVGYEIRDIPVPIQQIVEEEKKITMQ
GMVFGIEVKVLKTGTTLYQFYITDFTDSLMVKAFVKTKEDLKIYNLIANGKWIKVRGKVE
YDRFGQPPELMLIPNDINEIVAPMDRMDNAEHKRVEFHLHTTMSTMDGITPIGEYVKTAA
RWGHKAIAVTDHSGVQSYPDANKAGKKHGVKIIYGVEANVVNDSIPIVLNSIDLDLESTT
YVVFDIETTGLSVMNNRIIEIAGVKMQDGKVIGEFSSFVNPHEIIPYNITQLTHITDDMV
KDAPEIESVLPQFAQFIGDAVLVAHNARFDMGFIQANCKTLGMPELMNPVLDTLELARFL
FPSMKNHRLNTLADKFKISLDNHHRAIADAEALGHILSSLIKETSERNIRNLHHLNDYAG
IDLRNTRPFHCCIYAKNAIGKKNLYKLISISHTEHYNKVPSIPKSKLIQLREGLHINSGC
DKGEFFEAVLNKSLEEAEEVAAFYDVLEIQPIGNYMHLVDRGFVGSRESLELTVRRICEM
GDRLNKPVIATGNVHYLHPREKINRDITIFGITGFSPLKDQNKPDVHLRTTEEMLREFQF
LGESKAMEVVVSNTSKLADEFEEISLFPKKGGPADNGLFSPIFEGADDEIRETCYRTAAS
LYAEPLPEIVIARLEKELKPIIQYGFSANYLISEKLVKKSNEDGYLVGSRGSVGSSFVAT
MLGISEVNPLPPHYICRACKYNEFFTDGSIPSGFDLPSKPCPNCGENLRGEGQDIPFETF
LGFKGDKVPDIDLNFSGEYQAIAHNYTKILFGPENVFRAGTIGTVADKTAFGYVKKYEED
KGKSWRNAELNRLASGCTGVKRSTGQHPGGIVVVPDYIDVEEITPVQFPADDQSSEWKTT
HFDYHAFEENFLKLDILGHDDPTMMRMLQDLTGIDPTTIPMNDQKVMSIFNSTEAIGVEP
HQIRSPVATFGVPEMGTKFVRQMLQETKPTSFADLLQISGLSHGTGVWLGNAQELIKKGT
CDIKTVIGCRDDIMLYLIYKANMDASLAFKITESVRKGRGLTEEWKDDMKKHKVPAWYID
SCEKIEYMFPKAHAAAYVISAVRTAYFKVYHPIAYYATYFSVRAEDFDVELFCKGYDAIL
RKLLEIESKGFQALPKERAMISILEMGLEMTSRKLNFKSIDIYKSDASRFIIEGDSLIPP
FSSVAGVGENAAKLIAVAKEYGDFLSIEDFQQKSKVSKTVIELLNALGCFGAMPESNQLS
LF
NT seq 4329 nt   +upstreamnt  +downstreamnt
atgattaaaaaacgcgaacgatttgaattattgctgcaacaagcacttttttccagtgag
atcattaatgggcattttgctgaaggatacatagaccaggttgaggttagtcgcagtaac
agtcaatggacctttacgcttgctaagaaacaaatcctaccttctgacatttaccaaatc
ttctgtaaaacgatccgtgataagtttgctcacattgctcagattgactttatcgtgaaa
tatgatttagcagaagtttcgtcagatagcttaataaatacctattgggcgcattgcagt
gaatggatcaaaaaggcggtgccgtcgattaatggttatattagagatgccaaatatgag
ctcaatggcgatgtgattacggtaagtattttagaagaaattggcatggagatagtcaaa
aagaaaagcggagaattatggatccagcgttattttcgtgatttttttgctcgagaattt
accgtacgttttaatgtgactgaatctaacgaaattgagttaaaaagagtgcaatacttt
caacaaaacgagcaagaagataaaatgtttacgcagaacttagtttccgcgattgagaag
gatgtggaagcttccaaagctactgaaggcgaattaaagctcatggtaggttatgaaatc
agagatattccggtacccattcaacaaattgttgaagaagagaagaaaattacgatgcaa
ggcatggtttttggaattgaggtcaaggtgctcaaaaccggtacaaccctctatcaattt
tatataacggatttcacggactccttaatggtgaaggcctttgtcaaaacaaaagaagat
ctaaaaatatataatttaatagcaaatggcaagtggataaaggttcgcggcaaagtggag
tatgatcgttttgggcagccgccagagctgatgcttattcctaatgatatcaatgaaatc
gtcgcaccaatggaccgtatggataatgctgaacacaaaagggtcgaatttcatttacac
acgactatgagcactatggatggaattacacctataggtgaatatgttaaaacagcagct
cgctggggacataaagctattgcggttaccgatcatagcggtgtgcaatcctatccagat
gcgaataaggcagggaagaaacatggagttaagatcatttatggggttgaagctaatgtt
gtaaatgactctattcctattgtacttaactctattgacttggatttagagagtacaacc
tatgttgtttttgatatagaaacgacaggtctgtctgttatgaacaatcgaattattgaa
atcgctggagtgaaaatgcaagatggcaaggtgattggtgagttctcaagctttgttaat
ccgcacgaaattattccttataatattacgcagctaactcatatcaccgacgatatggta
aaggatgccccagaaatcgaatctgtgcttccgcaatttgcccagtttattggagacgcc
gtattagttgcccataatgctagatttgatatgggttttatacaagccaattgcaaaaca
ttagggatgccagaactcatgaatccggtcctagatacattggagcttgcacgtttttta
tttcctagcatgaagaaccaccgtttaaacacattggcagataaatttaagattagcttg
gataatcatcatcgggcgattgcggatgctgaagcacttggccacattttatcaagttta
atcaaagagacatcagagcgtaatatccgtaatttgcatcatttgaacgattacgcaggg
attgatttgcgtaatacacgcccgtttcactgctgtatttatgcaaaaaatgcgattggc
aaaaagaatttatataagttaatttctatttctcataccgagcattacaacaaagtacct
tcgattcccaagagtaaattaattcaattaagagaaggtctgcacattaattcaggctgt
gataaaggcgagttttttgaagctgtgcttaataaatccttagaggaagcggaagaagtt
gccgcattctatgatgttctggaaattcagcctattggcaactatatgcatttagtggac
agagggtttgtcggcagcagggaaagtctggagctgacggttcgccggatttgcgagatg
ggagatcggctgaataagccggtcattgctacgggcaatgtccattatctccatccacgc
gaaaaaataaatcgcgatattaccatctttgggataacagggtttagccctttgaaggac
cagaataaaccagatgttcaccttcgtacaacggaggaaatgctgcgtgagttccaattt
cttggcgagtccaaggcgatggaagtcgtggtaagcaatacttctaaactagcagatgaa
tttgaagagatatcgttgtttcctaaaaaaggcggccctgctgataatggcttattttcc
ccaatctttgaaggtgcagacgatgaaatccgcgaaacctgttaccgaacagcggcttcg
ctttatgcagagccattaccggaaattgttatagcccgtctagaaaaggaattgaaaccg
attattcaatacggtttctccgccaactatttaatttcagagaagctagttaaaaaatca
aatgaagatggttacttggttggatctcggggatcagttggatcttcttttgtagcgact
atgctcggtatatcggaagtaaatcccttgccgcctcattatatttgcagagcttgtaaa
tataatgaattctttacggatggcagtattccaagcggatttgatttacctagtaagcca
tgccccaattgtggagaaaacctaagaggagaaggtcaggatattccttttgaaactttt
cttggctttaaaggcgataaagttcccgatattgacttgaacttttctggggaatatcaa
gctattgctcataattatacaaaaattttgttcggtccggaaaatgtttttcgtgcagga
accattggtactgtggcggataagacggcatttggttatgtgaagaagtacgaagaggat
aaagggaaaagctggcgtaatgcggagttaaaccggcttgcttcaggctgtacaggagtt
aaacgcagcacaggccagcatcctggcggaattgtagttgttccggattatatcgatgta
gaagagattaccccagtgcagttccctgcggatgatcaaagctcagaatggaagacaact
cattttgactaccatgcattcgaagaaaatttccttaaactcgatatcctgggtcatgac
gatccgactatgatgcgaatgctgcaggacttaacaggaattgatccaacaaccattccg
atgaatgatcaaaaggttatgagtatttttaattcaactgaggcaattggggttgaacct
caccaaatccgttcaccagttgctaccttcggagtacccgagatgggcactaaattcgtt
cgccaaatgcttcaagaaacaaagccaacctcatttgccgatttattgcaaatatctggt
ttgtctcatggtacaggcgtatggcttgggaatgctcaggagttaattaaaaagggtact
tgcgatattaaaacggttatcggctgtcgggatgacatcatgctttatttgatttataaa
gctaatatggacgcaagcttagctttcaaaataacggaaagtgtacgtaaaggtagaggg
ttaaccgaggaatggaaagacgatatgaaaaagcataaagtacctgcttggtatatcgat
tcctgtgaaaaaattgagtatatgtttcctaaggcgcatgccgccgcttatgttatttcc
gcagtacgaacggcttattttaaggtgtaccatcctattgcctattacgcgacctacttt
agcgttcgtgccgaagattttgatgtggagttattctgtaaagggtatgacgcaattcta
cgaaaattattggagattgaatcaaaaggctttcaagctttgcctaaagaaagagcgatg
atttccattctggaaatgggcttggagatgacgtcacgcaagttgaatttcaaatccatt
gatatctataaatcggatgcatcgcgctttattatagaaggagattcgctaattccacct
ttttcatcggtagcaggtgttggtgaaaatgccgctaagctaatagcggtggcgaaggag
tatggtgacttcttatcaatagaagactttcagcaaaaatccaaagtttccaaaacagta
attgagcttctaaatgcgttaggctgctttggggcaatgcctgaatccaaccagctttca
ttattttaa

DBGET integrated database retrieval system