KEGG   Paenibacillus psychroresistens: EHS13_15995
Entry
EHS13_15995       CDS       T06328                                 

Definition
(GenBank) bifunctional oligoribonuclease/PAP phosphatase NrnA
  KO
K06881  bifunctional oligoribonuclease and PAP phosphatase NrnA [EC:3.1.3.7 3.1.13.3]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc00920  Sulfur metabolism
ppsc01100  Metabolic pathways
ppsc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    EHS13_15995
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_15995
Enzymes [BR:ppsc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     EHS13_15995
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.3  oligonucleotidase
     EHS13_15995
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  Other factors with a suspected DNA repair function
   Others
    EHS13_15995
SSDB
Motif
Pfam: DHH DHHA1
Other DBs
NCBI-ProteinID: QGQ96273
UniProt: A0A6B8RL49
LinkDB
Position
3578154..3579149
AA seq 331 aa
MSRNTATTYEQQLAAAKQFILSNDDFLVVSHIDPDGDAASSTLAIGWMLKQLNKKFTMIN
EGHTPGKFNFLWGFDGIIDYSKAAPSRTFEHVIAVDCADFSRIGKVKSLFSPTTQILNID
HHRTNDFYGAFQLIREDAAATAEVLYDLTMELQLNWSTELGDSIYTGLLTDTGGFRYANT
TPKVMRIAAEMLQVGVDGNDLADRLLEKLTYSHVILLQKALSTLAFTADKRISWVSVSLQ
DIAEAGASNEDLEGLVNYPRNIEGIEVGILFKEVETNKYKVSMRSAGIADVALIAKSFGG
GGHFRAAGCTIPGELQATITKVVKEVGLKLQ
NT seq 996 nt   +upstreamnt  +downstreamnt
atgagtcgaaatacagcaaccacatacgagcaacaattggcagctgccaagcaatttatt
cttagcaacgatgattttctagtggtatctcacatcgatcctgatggagatgccgctagt
tctacgttagccattggttggatgcttaagcagctgaataaaaaatttacgatgattaat
gaaggtcatacaccgggtaagtttaattttttatggggttttgacggaattattgattat
tctaaggcagcaccatcacggacttttgagcatgtcattgcggtagattgtgctgatttt
tcacgtattggcaaagtaaaatctctatttagcccaacaacgcaaattctcaatatagat
catcatcgtaccaatgatttttatggtgctttccagttaatccgcgaagatgctgctgca
acggcagaagttttgtatgatttaacgatggagctgcagctaaattggtctactgagtta
ggagattctatttatacgggtctattaacggatacaggtggttttcgatatgcaaacacc
acacctaaagtaatgcgtattgctgcagaaatgttgcaagtaggtgttgatggcaatgat
ttagctgaccgtttactggaaaagctaacttattcacatgttattttactgcaaaaggca
ttaagtacacttgcttttacagcagataagagaatctcatgggttagcgtatctttgcag
gatattgccgaagctggagcgtctaacgaagatctggaaggcttggtcaattacccgcgt
aatatagagggaattgaagtagggattttattcaaagaagtagagactaataaatataaa
gtcagtatgcgttctgccggaatcgccgatgttgcccttattgccaaatcatttggcggt
ggtggtcatttccgtgctgctggctgtacgatacctggcgaactacaagctactataact
aaggttgtcaaggaagtaggtctgaagctgcaatga

DBGET integrated database retrieval system