KEGG   Paenibacillus psychroresistens: EHS13_16030
Entry
EHS13_16030       CDS       T06328                                 

Definition
(GenBank) dUTP diphosphatase
  KO
K01520  dUTP pyrophosphatase [EC:3.6.1.23]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc00240  Pyrimidine metabolism
ppsc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    EHS13_16030
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_16030
Enzymes [BR:ppsc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.23  dUTP diphosphatase
     EHS13_16030
DNA repair and recombination proteins [BR:ppsc03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    EHS13_16030
 Prokaryotic type
    EHS13_16030
SSDB
Motif
Pfam: dUTPase
Other DBs
NCBI-ProteinID: QGQ96280
UniProt: A0A6B8RJ45
LinkDB
Position
3586368..3586847
AA seq 159 aa
MLRLKISGGISLSYKVEIKRLPGNEDIVLPQKMSDLASGFDLYAAVAEPLTLNPGERVLV
PTGFAIAMPAELEAQIRPRSGLAFKHGITALNSPGTIDADYRGEIKVLLINHGKEAFIIQ
RNERISQMVFQIVPQIQLEEVEELSDTVRGTGGFGHTGK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgttgcgattaaagatttcaggagggatcagcttgtcctataaggtggaaatcaaacga
ttacccggaaatgaagatatagtgctgccacagaaaatgtctgatttagcgagcggcttc
gatctgtacgctgctgtagctgaaccattaacgcttaatcccggtgaacgagtgctagtc
ccaacaggctttgcgattgcaatgccagctgagctggaagctcaaattcgtcctcgcagc
ggattagcctttaagcacgggatcacagccttgaattctcctggcactatcgatgctgat
tacagaggcgaaattaaggttttattgatcaatcacggtaaagaagcttttattattcaa
cgcaatgaacgcatttcccaaatggtattccaaatcgttccgcagattcagcttgaagag
gttgaagaattaagtgatacggttcgtgggaccggtgggtttgggcatacaggcaagtga

DBGET integrated database retrieval system