KEGG   Paenibacillus psychroresistens: EHS13_16145
Entry
EHS13_16145       CDS       T06328                                 

Definition
(GenBank) RecX family transcriptional regulator
  KO
K03565  regulatory protein
Organism
ppsc  Paenibacillus psychroresistens
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_16145
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    EHS13_16145
SSDB
Motif
Pfam: RecX Pex14_N Phage_TAC_12
Other DBs
NCBI-ProteinID: QGQ96302
UniProt: A0A6B8RL13
LinkDB
Position
3610250..3610984
AA seq 244 aa
MSHLMISMRCVSHYISKGGHIVEEEDEETIVLITSVEKQKRSRYRYNIFLNELFAFSVHE
DMLVKHRLLKGEYVNAARIEMIITEDEYHKAFMEALRFVGRRPRSRKEIEFKLAEKGYGE
DAVSRTIQKLLEQKIIDDEQFAHMWTEHRLFSQKKGRRWVQQELQQKGLSKEHIQEALSN
VDEEAEFQAAYDTAKKKWATIKGEPFERKHKLASFMLRRGYPSTMVNTVLKQVTGESLDE
LDMI
NT seq 735 nt   +upstreamnt  +downstreamnt
atgtcgcaccttatgatttcaatgaggtgcgtttctcattatataagtaaaggggggcat
atcgtggaagaggaagatgaagaaaccattgtattgatcacttcagtagagaaacaaaag
cgaagcaggtatcggtataatatatttttaaatgagctgtttgctttttcggtgcatgag
gatatgcttgttaaacatcgtttgttaaaaggcgaatatgtaaatgcagcaagaattgaa
atgattattacggaagatgaataccacaaagcattcatggaagcgctaagattcgttgga
cgacgtccaagatcacgtaaagaaatcgagtttaagctcgcggaaaaaggctacggggaa
gacgctgttagccgaaccatacagaagctcttagagcagaagattattgatgacgagcaa
tttgctcatatgtggaccgagcatcggctattctcacagaagaaaggcagacgttgggtt
cagcaagagctgcaacaaaaaggcctatcgaaagaacacatacaagaagccttatctaac
gttgatgaagaggcagagtttcaagctgcatatgatactgctaagaagaaatgggctact
ataaaaggggagccctttgaacgcaaacataaattagcaagctttatgctgcgaaggggg
tatcctagtacaatggtcaatactgtactgaagcaagtaacaggggaatcattggatgag
ctggatatgatctag

DBGET integrated database retrieval system