KEGG   Paenibacillus psychroresistens: EHS13_16495
Entry
EHS13_16495       CDS       T06328                                 

Definition
(GenBank) deoxyribonuclease IV
  KO
K01151  deoxyribonuclease IV [EC:3.1.21.2]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    EHS13_16495
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_16495
Enzymes [BR:ppsc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.2  deoxyribonuclease IV
     EHS13_16495
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     EHS13_16495
SSDB
Motif
Pfam: AP_endonuc_2
Other DBs
NCBI-ProteinID: QGQ96367
UniProt: A0A6B8RKK7
LinkDB
Position
3680336..3681181
AA seq 281 aa
MYIGAHVSTKGGYAAAAKFAFRNGASAFQYFPKNPRSLNIKSFNVSDAVACAQFCAENSL
VSIGHAPYPLNLAVVQDQQAVMVDALLNGLEITDTCGSIGLVVHFGRFSGKDTLEGYKHI
LQVLNETLQQWQGRALILLENQAGSGNPMGTTFEELTQIRSLSNYPDKIGFCLDTCHAFA
SGLWNGANWSEVEANGERLGFWTHLKAIHLNDSLYPTGSFRDRHANIGQGFIGSEHLTAV
LSSAFVRDTAIVLETAPAADGTHRDEINYIRELMSVTKAKS
NT seq 846 nt   +upstreamnt  +downstreamnt
atgtatatcggagctcatgttagcactaaaggcggttatgcagcagcagctaaatttgcc
tttcgcaatggagcgagtgcttttcaatatttccccaaaaatccgcgaagtttgaatatc
aagtccttcaacgtatccgatgcagtagcatgtgcgcagttttgtgctgagaattcactt
gtttccataggccatgctccctatccattaaatttagccgttgtacaagatcaacaagct
gtcatggttgatgcacttttgaatggacttgaaataacagatacttgtggatctatcgga
cttgttgtccattttggcaggttttcgggtaaagatactttagaggggtacaagcatatt
ctgcaggtattaaatgaaaccctacagcaatggcagggacgggcgctcatcttactggag
aatcaggcaggcagcggcaatcctatggggactacatttgaagaactaactcagattcgt
tcactgtccaattatccagataaaatcgggttttgcttagatacctgccatgcttttgcc
agcggattatggaacggagccaattggagtgaggttgaagctaatggagaaaggcttgga
ttctggacgcaccttaaagccatccacttgaatgattctctctatccaacagggtcgttc
cgcgaccgtcatgcgaatattggccaaggctttattggaagtgagcatttaactgccgta
ttaagctcggcttttgtacgggatactgccattgtgttggagacggctccagcggcagac
ggcacgcatcgggatgaaataaattatattagagaattgatgtctgtaactaaagcaaaa
tcttaa

KEGG   Paenibacillus psychroresistens: EHS13_26770
Entry
EHS13_26770       CDS       T06328                                 

Definition
(GenBank) deoxyribonuclease IV
  KO
K01151  deoxyribonuclease IV [EC:3.1.21.2]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    EHS13_26770
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_26770
Enzymes [BR:ppsc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.2  deoxyribonuclease IV
     EHS13_26770
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     EHS13_26770
SSDB
Motif
Pfam: AP_endonuc_2 Ala_racemase_N PRMT5_TIM
Other DBs
NCBI-ProteinID: QGQ98231
UniProt: A0A6B8RPE2
LinkDB
Position
complement(5884729..5885838)
AA seq 369 aa
MVKIGSHVSFSETGLLNAAKEAATYGSGTFMIYTGAPQNTRRKPIEEQYIEEGKAVMAEH
GMEDIVVHAPYIINLASYKKDTFELATRFLQEEMRRTDYIGVRNIVLHPGAYTDKDAEYG
IAKIAEGLNEVLRGVKDTKVNIALETMAGKGSELGRSFEELAAIIEKVEDNARLKVCMDT
CHIHDAGYDIVNDFDGVLAHFDRVVGLDRLAVLHLNDSKNMRGAGKDRHAPIGAGMIGFK
AIQAIVQHEKLGHIPMILETPWIGKNDKTQRPMYETEIALLRGNTEARFGVEFLDQVERL
DHFFSKQSIDHREFVLNTWDLLKNDEKAKKVDKREPMERLYDLIEAEQLFKELSEEQINQ
RLTAWFASK
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggtgaaaattggttcacacgtttcattttcagaaactggcttattaaatgcagcaaaa
gaagcagcaacctatggttcgggtacttttatgatttatacaggggcaccgcaaaatacg
cgaagaaagccaattgaagagcaatacattgaagagggcaaagcggtcatggccgagcat
ggtatggaagatatcgtcgtacatgcaccttatatcattaatttagcttcctataagaag
gatacctttgaattagctactcgtttccttcaggaggaaatgcgccgtactgattatatt
ggagttcgtaatatcgtgcttcatccaggtgcctatacagataaagatgcagaatatggg
atagcgaaaattgcagagggcttaaacgaagtgttgcgtggagttaaggatacaaaagta
aatattgctcttgaaacgatggctggaaaaggctctgagcttggccgcagctttgaagag
ctagctgctattattgaaaaagtcgaggataatgctcggctgaaggtttgtatggatacc
tgtcacattcatgatgcaggctatgatattgtcaatgattttgatggggtattggctcac
tttgatcgagttgttggattggaccgtttagcagtgcttcatttaaatgatagtaagaat
atgcgaggcgcaggcaaggatcgccatgctcctataggtgcagggatgatcggctttaaa
gcgatacaagcgatcgttcagcatgagaagctcggccatatcccaatgattcttgaaaca
ccttggattggcaagaatgacaaaacacagcgtccgatgtatgaaacagaaattgcctta
ttgcgtggaaatacagaagcgcgttttggagttgagtttctcgatcaagtagagcggttg
gatcatttctttagtaaacaatctatcgatcatcgtgagtttgtattaaatacttgggac
ctgctcaaaaatgacgagaaagcgaaaaaagtggacaagcgtgaacctatggaacgttta
tatgatttgattgaagctgagcagttattcaaggaattgtcggaagaacagattaatcaa
cgattgacggcttggtttgcaagtaaataa

DBGET integrated database retrieval system