KEGG   Paenibacillus psychroresistens: EHS13_17995
Entry
EHS13_17995       CDS       T06328                                 

Definition
(GenBank) ATP-dependent DNA helicase
  KO
K03722  ATP-dependent DNA helicase DinG [EC:3.6.4.12]
Organism
ppsc  Paenibacillus psychroresistens
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_17995
Enzymes [BR:ppsc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     EHS13_17995
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  Other factors with a suspected DNA repair function
   DNA helicases
    EHS13_17995
SSDB
Motif
Pfam: Helicase_C_2 DEAD ResIII DEAD_2 LIM
Other DBs
NCBI-ProteinID: QGQ96632
UniProt: A0A6B8RLV2
LinkDB
Position
complement(3982819..3984768)
AA seq 649 aa
MKRYPFAYDASQSFVQQASDWIADVFYEVLPEVGFEVRDEQIYMAFQLERAFADKKTIFA
EAGVGTGKTLVYLLYSIFYARHTRKPAIIACADESLIEQLVKPEGDIAKLAKHLNLTIDA
RLGKSQDQYLCVKKLGEVRNPNDETQVFQQIYSQLPEFVEKYEALQAFYPYGDRREYAHL
NDEQWREINWDTFQDCFVCDKRHRCGQTLSREHYRKSADLIICSHDFYMEHVWTYEGRKR
EGQLPLLPEHCAVVFDEGHLLENAAQKALTYKLNHEVFEEIIIRLLKGEVRESFALVVEE
AISQSEALFKLLRKQSKSVIGSDRKEINYNPLLVREVNRFRDLIATIEDELVFESELYTL
DMYQLKIVEEHLEMIQLALALFKQSDQLIAWVMEDTVGLTLVIMPRLVKEVLNERVFTQK
MPIVFSSATLSIDGSFDYVADNLGIESYLSFSVPSPHDYENQMKFIAPRLNENFTIADKM
QLVVRLLQETEGRALILFPSKEEMRQFKQDILQYDACKDMRFGFEGDQEISYLISAFQND
EQSVLCAVTLWEGLDIPGPSLSNVIIWSLPFPPNDPVFSARRKASQSAFEEVDLPYMLLR
LRQGMGRLIRSKDDRGIVAILSLELYENEVVRKKVQEILPNGVEWNETF
NT seq 1950 nt   +upstreamnt  +downstreamnt
gtgaaacgatatccttttgcctatgacgcttcacaatcatttgtgcaacaagcaagtgat
tggatagcagatgtattctatgaagtattaccggaagtcggctttgaagtacgtgatgaa
caaatttatatggcctttcaattagaacgggcttttgccgataagaaaaccatttttgct
gaggcaggtgttggtaccggtaaaaccttagtttatttactttattcgattttctatgcg
cgacacacacggaaaccagccatcattgcttgtgcggacgaatcattaattgaacaatta
gttaagcccgaaggtgatattgcaaagcttgccaaacatttaaatttaaccattgatgcc
cgcttgggtaaatctcaggatcaatatttatgtgttaaaaagctaggtgaagtgcgtaac
cctaatgatgagacccaagtttttcagcaaatatatagtcaattgcctgaatttgttgag
aaatatgaagccttacaagcgttttatccttacggggatcgcagagagtatgcacattta
aacgatgaacaatggagagagatcaattgggataccttccaggattgttttgtttgtgat
aaacgccatcgttgtggacagactttatcgagagagcattatcgtaaatccgcagattta
attatttgctcgcatgatttctatatggagcatgtttggacctatgaaggtagaaaaaga
gaaggccagctgcctttattgcctgagcattgtgcagtcgtttttgatgaaggccatttg
ttggagaatgcagctcaaaaagccttaacctataagttaaatcatgaggtttttgaagaa
attattattcgattgcttaaaggggaagtgcgtgaatcctttgcgctggttgttgaagaa
gccatttcacagagtgaagctttatttaagctattacgcaaacaaagcaaatctgtaatt
ggctctgatcgcaaagaaatcaattataatcccctattagtccgcgaggttaatcgcttc
cgtgatctaattgcaactattgaagatgaattggtatttgaaagtgagctttatacttta
gatatgtaccagctgaaaattgtcgaagagcatttggagatgatccagcttgctttggcg
ttatttaaacaatccgaccagctaatcgcttgggttatggaagatacagtggggctaacc
ttggtgattatgccaagactagttaaggaagtactgaacgagcgtgtcttcacacagaag
atgccgattgtattttcttccgcaacgctttctattgatggatcctttgactatgttgct
gataatttaggcattgaaagctatttatccttctcagttccttctccacatgattatgaa
aaccagatgaaattcattgcaccacggttgaatgagaattttactattgctgataaaatg
cagttggttgttcgtttattacaggagactgaaggtagagctttaattctctttccttct
aaagaagaaatgagacaattcaaacaagatattctgcaatacgatgcttgcaaggatatg
cgcttcggttttgaaggtgatcaggaaatcagctatctgatttcagccttccagaatgat
gaacaaagtgttctatgtgcagtaacgctttgggaaggactggatattccagggccatcc
ttatcgaatgtaatcatttggtcattgccgtttcctccgaatgatcccgtgttctcagca
agaaggaaagcatcccaatccgcctttgaggaagtggatcttccctatatgctgctaagg
cttagacagggcatggggcgccttattcgttctaaggatgatcgtggtattgtagccatt
ctaagtttggagttatacgagaatgaagtagttcgtaaaaaggtccaagaaattttacct
aatggtgtcgaatggaatgaaacgttttaa

DBGET integrated database retrieval system