KEGG   Paenibacillus psychroresistens: EHS13_18455
Entry
EHS13_18455       CDS       T06328                                 

Gene name
mutL
Definition
(GenBank) DNA mismatch repair endonuclease MutL
  KO
K03572  DNA mismatch repair protein MutL
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    EHS13_18455 (mutL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_18455 (mutL)
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Molecular matchmaker
     EHS13_18455 (mutL)
SSDB
Motif
Pfam: MutL_C DNA_mis_repair HATPase_c_3 HATPase_c
Other DBs
NCBI-ProteinID: QGQ96719
UniProt: A0A6B8RL06
LinkDB
Position
complement(4098185..4100068)
AA seq 627 aa
MGIIHVLDDHIANQIAAGEVVERPSSVVKELVENSVDAGSTTIDVTIEEGGLQLIRVVDN
GSGIEQDDCELAFFRHATSKINSGKELFQIRTLGFRGEALPSIAAVSKVECTTSTTKNGL
GRTLIIEGGTVRSFVEAAARQGTDFKVRELFYNTPARLKYMKTIQTELGNVSDYIYRLAM
AHPQIAFTLRHNDNLLLQTLGNGDLLQVIAAVYGSTSAKQLIPVQEESLDYTVQGYVSKP
EWTRANRSGITTIINGRYIRNFALAQTILHAYHTYLPINRYPVAVLHITMDPSLLDVNVH
PSKLEVRFSKEPELLACLVKTIEDGLKKVNLIPQGGQQRKLDKPAVVQEQMELYRPTTTP
NSQAPSRSVPSSTALSSSTPNNYSFPKPTIDFTRAKVNEYVPMPAPERKSVPYDAVQRLM
QPAVELEQPIKLPSFPELTPIGQLHGTYIVAQNELGLFLIDQHAAHERIHYEYYYEQFGH
PADASQQLLVPITLDFTPTDAAMLKLKLDIFVQAGVYIEHFGGQSFIVRAYPHWFPAGEE
QAIIEEMAEWILAEKKAIDLTKIREKAAIMCSCKASIKANQFQTIAEMEALLERLGACKV
PYTCPHGRPIVVSFSTHELEKMFKRVM
NT seq 1884 nt   +upstreamnt  +downstreamnt
atgggtataatacatgttttagatgatcatattgctaatcagattgctgcgggcgaagta
gtagagcggccttcctccgtagtgaaggagcttgtagaaaacagtgtcgatgctggcagt
acgacaattgatgttaccattgaagaaggtgggctgcagctaattcgagtggtagacaat
ggttcaggaatcgaacaggacgattgtgagctcgccttttttcgccatgcgacaagtaaa
atcaactcaggcaaggaattgtttcagattcggacgcttggctttcgtggtgaggcatta
cccagtattgctgccgtttccaaggttgaatgcacaacatccaccactaagaatggtctg
ggcaggacgctgataattgaaggcggcacggtacgctcttttgtcgaggcggcggcacgc
caaggaacagattttaaagttcgcgaattgttctacaatacacctgcacggttaaagtac
atgaagacaattcagactgaacttggcaacgtatccgattatatataccgattagccatg
gcgcatccgcagattgcctttactctgcgacataatgacaatctattgctgcaaaccttg
ggcaatggcgatctattgcaggttatcgctgctgtatatggttcaacgtctgctaagcag
ttaatccctgtacaggaggaaagtttagattacacggttcaaggctatgtctctaaaccg
gaatggacacgagccaatcgctcaggcattaccacgattattaacggccgttacatccgt
aattttgctttagcacaaacgattctacatgcttatcatacttacttaccgattaatcgc
tatcctgttgctgttttgcatattacgatggatccgtccttgcttgatgtcaatgttcat
ccatccaagcttgaggttcgatttagtaaagaaccggagctgcttgcttgtctggtcaaa
acgattgaagacggtttaaagaaagttaacttgataccgcagggaggtcaacagcgcaag
ctggataaacccgctgtggttcaagaacaaatggagctttatcgaccaacaacgactcca
aatagccaagccccaagcagatcagtacctagcagtacagctctaagcagctcaacacca
aataactatagctttcctaaaccgactatagatttcacacgagctaaagtaaatgaatat
gtacctatgcccgctcctgaacgtaaatcggtaccatatgatgccgttcaaagattaatg
cagccggcagtcgagttggagcaacctattaaactgccatcattcccagagttaacgcct
attggtcaattgcatgggacttacattgtggctcagaacgaattgggtttgttcttaatt
gaccagcacgcagctcatgaacggattcattatgaatattattatgagcaatttggccat
ccagctgacgccagtcagcaattattagtcccgattaccttggacttcacacccacggat
gcggccatgctcaagcttaaattagacatattcgtccaagcaggtgtatatattgagcat
tttggcgggcaatcttttatcgtccgtgcttatcctcattggtttccagcaggcgaagaa
caagcgattattgaggaaatggcggagtggattctcgctgagaaaaaagcgattgatcta
actaaaattcgtgagaaggcggccatcatgtgctcatgtaaagcctcgatcaaagctaac
caattccagacgattgcggaaatggaagccttgttggagcgtctgggtgcttgtaaagtt
ccttatacctgcccgcatggaagacccattgtcgttagtttttctacgcacgagcttgaa
aaaatgttcaaacgggtgatgtaa

DBGET integrated database retrieval system