KEGG   Paenibacillus psychroresistens: EHS13_18890
Entry
EHS13_18890       CDS       T06328                                 

Gene name
gyrA
Definition
(GenBank) DNA gyrase subunit A
  KO
K02621  topoisomerase IV subunit A [EC:5.6.2.2]
Organism
ppsc  Paenibacillus psychroresistens
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ppsc03032]
    EHS13_18890 (gyrA)
   03036 Chromosome and associated proteins [BR:ppsc03036]
    EHS13_18890 (gyrA)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:ppsc02048]
    EHS13_18890 (gyrA)
Enzymes [BR:ppsc01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     EHS13_18890 (gyrA)
DNA replication proteins [BR:ppsc03032]
 Prokaryotic type
  DNA Topoisomerases
   EHS13_18890 (gyrA)
Chromosome and associated proteins [BR:ppsc03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    EHS13_18890 (gyrA)
Prokaryotic defense system [BR:ppsc02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    EHS13_18890 (gyrA)
SSDB
Motif
Pfam: DNA_topoisoIV DNA_gyraseA_C MRG Nnf1 Allexi_40kDa
Other DBs
NCBI-ProteinID: QGQ96799
UniProt: A0A6B8RL81
LinkDB
Position
complement(4187692..4190133)
AA seq 813 aa
MSVNEQISPAFLEDLVGDRFGRYSKYIIQDRAIPDVRDGLKPVQRRILYAMYDSGNTPDK
IYRKSAKTVGDVMGNYHPHGDSSIYEGMVRMAQPWKMGHVLVDGHGNWGSQDDDPAAAMR
YTEARLSEIAMELLRDIDKRTVLFKDNFDNTTKEPTVLPSRYPNLLVNGVSGISSGFATD
IPPHNLREVINACIAMMDNPQITLEQIMGIIKGPDFPTGGIIMGEEGIREAFQTGKGRIY
LRSKTSIEDMRGGRQQIVITEIPYQVVKSRLVTAMENLRLEKKVEGIAEVRDESGRNGLR
IVIELKKEADAQGILSYLLKKTDLQVAYSFNMVAIVNKTPRQLGIKDILEAYIEHQKEVV
TFRSQYELDKAADRAHVLEGLAKALNILDEVIATIKASKNRLDAQKNLVSAYGFTERQAD
AILILQLYRLTNLEIHSLEKELKEVNKNIAYLKSILGSLNKLLSVIKEEMSEIRDKYGID
RRSEIQGEIEELKVNLEVMVVAEDVLVTISNEGYLKRTSLLSFTRSGGDMNTIGLKEGDY
VRYRLDVNTIHNLLIFTQKGQYYLLPVHQIPEFKWKENGTAIVNVIPIPKEDRIVSVIPI
KDFNDEEKSLVFVTRKGQVKRTELKEYYTNRSIGIVGCKVSELDEVIQVKLTDGRKDIIL
VTAQGMSIRFKEVEVNAMGRVATGVRGIQLKDQDVVIAAEWVEGEEGELMVVSDLGYVKS
SLLLDYPIQGRGGKGIVTFEFKEGKRVRPNGTTLIRAYAIKEACTMVAIISGGEKITFST
ETAPIEDRKSIGKLLIPYAKGSRILELLKLPQA
NT seq 2442 nt   +upstreamnt  +downstreamnt
atgagtgtgaatgagcaaatttcaccagcctttttggaggatttggtaggggaccgattt
ggacgctattctaaatatattattcaagatcgcgctatacctgatgttagggatggttta
aagcctgtgcaacgccgaattctctatgcgatgtatgattcaggcaatacccctgataaa
atttaccgtaaatcagcgaaaaccgttggtgatgtcatggggaattaccatccgcatggt
gactcttcgatttatgagggtatggtacggatggctcagccttggaaaatggggcatgtg
ctagttgatggccatggcaactggggatcacaggatgatgatccagcagcagccatgcgt
tatacggaagctcgtttgtccgaaatcgcaatggaattactaagagacattgataaacgt
accgttttgtttaaagataactttgataatacaaccaaggaaccaacggtattgccatct
cgttatcccaatttgctcgtaaacggggttagcggcatatcctcaggctttgcgacagac
attcctccgcataatttgcgcgaggttattaatgcttgcatcgcaatgatggataatcct
caaataactttagaacagattatggggatcataaaaggacctgattttccaacgggtgga
attatcatgggcgaagaggggattcgcgaagcgttccaaacaggaaaaggccgaatttac
cttcggtcgaaaacctccattgaagatatgcgtggcggacgccaacaaatcgtgattacg
gaaataccctaccaagtggttaagtcgcgtttagttacagccatggaaaatctgcgtctt
gagaaaaaagtcgagggaatcgccgaggttcgtgacgaaagtggacgtaatggcttaaga
attgtgattgagcttaaaaaagaagcagatgctcaagggattttgtcctatttgctcaaa
aaaactgatctgcaggtggcatatagctttaatatggttgccattgtcaataaaacccct
cgtcaactaggaatcaaggatatattagaggcttatattgagcaccagaaggaagttgtt
accttccgctcccaatatgagcttgataaagcggcagaccgtgcacacgtacttgaaggg
cttgcaaaagcgcttaatatcttagatgaagtgattgcgacgattaaagcttctaaaaac
cgcttagatgctcaaaagaacttagtaagtgcatatggctttaccgaacgccaagcagat
gccatcctaattctccaattgtatcgtttgaccaaccttgaaattcattctttggaaaaa
gagcttaaagaagtcaacaagaatatcgcctatcttaaatcaattcttggcagcttaaat
aagctcctaagcgtcattaaggaagagatgagcgagattcgtgataaatatgggatagat
cgccgctctgagattcagggggagattgaagagcttaaggttaatctagaggtaatggta
gtcgccgaagatgtactggtaacgatttctaacgaaggttacttgaagcgtaccagttta
ttatcctttacccgatcaggcggggatatgaatacaattggcttaaaggaaggcgattat
gttcgctatcgtttggatgtgaataccatccataatctgcttatcttcacccaaaaaggc
caatattacttattgcctgtccatcaaattccggagttcaaatggaaagagaatggtaca
gcgatcgtgaatgtcattcctattcctaaggaagatcgaattgtatctgttattccgatt
aaggattttaatgatgaagagaaatcactcgtgttcgtaactcgaaaagggcaagtgaaa
cgaactgagcttaaagaatattatacgaaccgttctattggtattgttggttgtaaggtt
agtgaactggacgaagttatccaggtgaagcttacagacggccgtaaagacatcatctta
gtaacggcgcaagggatgagcattcggtttaaagaagttgaagtgaatgcgatgggtcga
gtggctactggggtacgcgggattcaattaaaagatcaggacgttgttattgcagcagaa
tgggtggaaggcgaagaaggagagctaatggtcgtatccgatttaggctacgtaaaaagc
tctttgctgctggattatccaattcaaggacgcggcggtaaaggaattgttaccttcgag
tttaaagaaggcaagcgcgtccgtccgaatggaactacattaatccgtgcatatgccatt
aaagaagcctgtacgatggtcgcaataattagcggcggagagaaaattaccttctcaacc
gaaacggcaccgattgaagatcgtaagtcgattggtaaattactaatcccgtatgctaag
ggaagccgaattctggagctattgaagcttccacaggcttaa

DBGET integrated database retrieval system