KEGG   Paenibacillus psychroresistens: EHS13_18895
Entry
EHS13_18895       CDS       T06328                                 

Gene name
parE
Definition
(GenBank) DNA topoisomerase IV subunit B
  KO
K02622  topoisomerase IV subunit B [EC:5.6.2.2]
Organism
ppsc  Paenibacillus psychroresistens
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ppsc03032]
    EHS13_18895 (parE)
   03036 Chromosome and associated proteins [BR:ppsc03036]
    EHS13_18895 (parE)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:ppsc02048]
    EHS13_18895 (parE)
Enzymes [BR:ppsc01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     EHS13_18895 (parE)
DNA replication proteins [BR:ppsc03032]
 Prokaryotic type
  DNA Topoisomerases
   EHS13_18895 (parE)
Chromosome and associated proteins [BR:ppsc03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    EHS13_18895 (parE)
Prokaryotic defense system [BR:ppsc02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    EHS13_18895 (parE)
SSDB
Motif
Pfam: DNA_gyraseB DNA_gyraseB_C HATPase_c Toprim HATPase_c_3 RteC
Other DBs
NCBI-ProteinID: QGQ96800
UniProt: A0A6B8RKI5
LinkDB
Position
complement(4190146..4192122)
AA seq 658 aa
MAEQLEIEKKDPKPPNSNYEADDIQVLEGLVAVRKRPGMYIGSTGPSGLHHIVWEIVDNA
VDEHLAKHCSAIDLVIHRDQSISVRDNGRGIPTGMHKTGVPTPQVVFTILHAGGKFGGSG
YKKSGGLHGVGASVTNALSEWLEVEISRDGKIHKQRFEYWVDANDKEHVGQPTTGLDVMG
TTNKTGTKVTFKPDKRVFQAGIAVNYDTLSERLQEIAFLNSGLKVSIKDERSDKQDTYQY
EGGAKQFVEFLNEDKTVLHKVVHFTGEKDDIEVEVALQYNDGYTETLASFVNSIPTRGGG
THETGFKAAYTRVLNDYARKMTILKEKDKNLEGSDLREGMMIVLNIKMGEVEFVGQTKDQ
LGSSSARSVVDSIVADRMAVFLEENPNDAQMMLKKAVQSARAREAARKAREEIRSGKKGK
SESSNLNGKLTPAQSKDYQRNELFIVEGDSAGGSAKQGRDSKHQAILPLKGKPMNPEKAK
LLDILKNEEYKAIIAAIGAGVGPEFDQEETNYGKIIIMTDADTDGAHIQVLLLTFFYRYM
KPLIDAGKVYIAQPPLFKVTKKAGKNTQMKYAYTDDDLSKITKEFGGNVELQRYKGLGEM
NPDQLWETTMDPELRTLFQVQIEDAAKAERRVSTLMGDKVDPRKRWIIENVDFTEYVE
NT seq 1977 nt   +upstreamnt  +downstreamnt
atggccgaacagctagaaatagaaaagaaagatccaaagccaccgaattcgaactacgaa
gcggatgatatacaggtactagaagggcttgttgcagtacgtaaaaggccgggtatgtat
atcggcagcacaggtccatccgggttgcatcatattgtttgggagattgttgataatgca
gtggacgagcatttagcgaagcattgctctgcgattgatttagttatccatcgcgatcaa
tcgataagcgtacgtgataatggtcggggaattccgacaggcatgcacaagacgggggtg
ccgacacctcaggttgtgtttacaattttgcatgctggcggtaaatttggtggttctggt
tataagaaatcaggtggcttgcatggagtaggcgcttccgtgacgaacgctttatcagaa
tggctggaagttgaaatttcacgtgatggtaaaatacataaacaacgttttgagtattgg
gtggatgcaaacgacaaagaacatgtagggcagccaactacaggattagatgttatgggt
acgactaataaaacaggaacaaaggttactttcaaacccgacaaacgtgtatttcaagca
gggattgccgtaaactatgatacattgtcagagcggctgcaggaaattgcttttctaaat
tcaggtttgaaggtaagtattaaggatgagcgctcagataaacaggatacttatcagtat
gagggtggagccaagcaatttgttgaattcttaaatgaggataaaacagttttgcataag
gttgtccattttacgggcgagaaggatgatattgaggttgaagtcgctttgcagtataac
gatggatatacggaaaccttagcttccttcgttaattccatccccactcgtggaggcgga
acccatgaaacgggctttaaggcagcctatacccgggttttaaatgattatgcgcgaaaa
atgactattttgaaggaaaaggataagaatttagagggttcagatttacgtgaaggcatg
atgattgtgcttaatattaagatgggcgaggttgagtttgttggccaaaccaaagaccag
ctaggaagttcgtctgctagaagcgttgtagattccattgtagcggatcgtatggctgtt
ttccttgaagaaaatccaaacgatgcacaaatgatgctgaagaaagccgttcaatctgca
agagcaagagaagcagctcgtaaagcacgcgaagaaattcgcagcggcaaaaaaggcaaa
agcgaaagctctaatctcaacggtaaattaacacctgcccaatcgaaggattatcaacgc
aatgagctgtttattgtcgaaggggattccgctggaggctctgccaagcaaggccgtgat
tcaaagcatcaagcgatcctgccgttaaaaggcaagccaatgaatccagagaaagccaag
ctgctcgatattctgaagaatgaagagtataaagcgattatcgcggcgattggtgctggg
gtaggacctgaattcgaccaggaagaaaccaattatggaaaaattattatcatgacagat
gcggatacagatggcgcacatattcaagtactgctgctgacattcttttatcggtatatg
aagccgttgattgatgcaggaaaagtatatattgcacagccgccgttatttaaagtgact
aaaaaagccggcaaaaatacgcaaatgaaatatgcctataccgatgatgatttaagcaag
attactaaagagtttggcggtaacgtggaactgcagcgatataaagggcttggagaaatg
aatccggatcaattatgggaaactacgatggatccagagcttagaactttgtttcaagtg
caaattgaagatgcagctaaggcagagcgtcgcgtttccaccttgatgggcgataaagtt
gacccgcggaagcgttggattattgaaaatgtagattttacggaatatgtggaataa

DBGET integrated database retrieval system