KEGG   Paenibacillus psychroresistens: EHS13_19370
Entry
EHS13_19370       CDS       T06328                                 

Definition
(GenBank) HU family DNA-binding protein
  KO
K03530  DNA-binding protein HU-beta
Organism
ppsc  Paenibacillus psychroresistens
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ppsc03032]
    EHS13_19370
   03036 Chromosome and associated proteins [BR:ppsc03036]
    EHS13_19370
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_19370
DNA replication proteins [BR:ppsc03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    EHS13_19370
Chromosome and associated proteins [BR:ppsc03036]
 Prokaryotic type
  Nucleoid associated proteins
   HU (heat unstable protein)
    EHS13_19370
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Supressor
      EHS13_19370
SSDB
Motif
Pfam: Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 Peptidase_C80 DUF2267
Other DBs
NCBI-ProteinID: QGQ96890
UniProt: A0A6B8RKR6
LinkDB
Position
complement(4284847..4285119)
AA seq 90 aa
MNKSELISKVAELSELSKKDATKAVESVFEAISDALKGGDKVQLVGFGNFEVRERSARKG
RNPQTGQEIEIAASKVPSFKPGKALKDGIQ
NT seq 273 nt   +upstreamnt  +downstreamnt
atgaataaatccgagttgatttcaaaagtagctgaattgtccgagcttagcaaaaaggat
gcaactaaagcagttgaatctgtttttgaagcgatttccgacgctctaaaaggcggcgat
aaagtacaattagtaggttttggtaactttgaagttcgtgaacgttctgcacgtaaagga
cgcaatccacaaacaggtcaagaaatcgaaatcgcagcaagcaaagtaccatcgtttaaa
ccgggcaaagcacttaaagacggtatacagtaa

DBGET integrated database retrieval system