KEGG   Paenibacillus psychroresistens: EHS13_19590
Entry
EHS13_19590       CDS       T06328                                 

Gene name
recG
Definition
(GenBank) ATP-dependent DNA helicase RecG
  KO
K03655  ATP-dependent DNA helicase RecG [EC:3.6.4.12]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    EHS13_19590 (recG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_19590 (recG)
Enzymes [BR:ppsc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     EHS13_19590 (recG)
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     EHS13_19590 (recG)
SSDB
Motif
Pfam: Helicase_C DEAD RecG_wedge ResIII SecA_DEAD DUF4350
Other DBs
NCBI-ProteinID: QGQ96931
UniProt: A0A6B8RKJ3
LinkDB
Position
complement(4326538..4328586)
AA seq 682 aa
MDLYTIPVKNVRGVGTQKTEELLLIGIQTVAQLIEYYPFRYEDYQLRDLTEVKNGEKITV
QGTIYSEPLLQMYGKTKSRLTCKVVVENFFVTAVWFNRHFLKDKLKLGQEIILTGKWDQG
RRHLSVSESEFPGQGTTRIGTLQPVYSVAGPITQQWMRKTMMQAFSQFGEMIEENLPQDL
KLKHNFLPRKQAIYHIHHPVDITEGKHARARVVYEEFFFFQLKIQAYRALSRSKAEGSAF
AVDLPAVRAFVRALPFVLTDSQKHVIGEIMHDLQQPYSMNRLLQGDVGSGKTIVAAVALF
AVIRTGAQGALMVPTEILAEQHYRSLTRLFEPYGISVGLLTGSLTERIRRGIISSLQTGE
LQILIGTHALIQEDVYFHNLGLVVIDEQHRFGVQQRSILRRKGLHPDVLTMTATPIPRTL
AITAYGDMDVSSLRELPKGRKPIRTYSVNHNMLERVLGFISREVLAGRQAYLICPLIEES
EKVDVQNAMDLHAQLTQHFPDFRVGLLHGRLPTVEKDHVMREFSENKIQVLVSTTVIEVG
VDVPNATIMVVYDAQRFGLSQLHQLRGRVGRGEHASYCILIAEAKSEVSKERLKVMTETN
DGFEIARRDLELRGPGDYFGTKQSGLPEFRLADLVSDFEVLELARDDVAELLMRTDFWTG
LEYLAFRQFLQREQIFGEGLID
NT seq 2049 nt   +upstreamnt  +downstreamnt
atggatttatatacaattcccgtgaaaaatgttcgcggagtcggtacacaaaaaacagag
gagctgctgctgattggcattcaaaccgtagcgcagctcattgaatattatccatttcgt
tatgaggattatcagcttcgtgatttaacggaagtgaagaacggcgagaaaattacagtc
caaggcaccatttatagtgaacctctgctgcaaatgtatgggaaaaccaaatcgagacta
acctgtaaagtggttgtcgagaatttttttgtcacggctgtatggtttaatcgtcatttt
ctaaaagataagcttaagcttggccaagaaattatactaactggaaagtgggaccaaggc
cgacgtcatctttccgtttcggagtcggagttccctggacaaggaactacacgtataggt
acactgcagcctgtatactccgttgcaggacccatcacacagcaatggatgcgtaaaacc
atgatgcaagccttttcgcaattcggcgagatgattgaggagaatttacctcaggattta
aaactgaagcataactttttaccacgtaaacaagcgatttatcatattcatcatccagtg
gatataacagaggggaaacacgcgcgcgctcgtgttgtttacgaagagttcttctttttc
cagctcaaaatccaagcctaccgggcattatcgcgcagtaaagcagaagggtctgcattt
gctgtggatttaccggctgttcgtgctttcgtaagagcattgccttttgtactcacagat
tctcagaagcatgttattggcgaaattatgcatgatctgcagcagccttatagcatgaac
cgtttacttcagggtgatgtggggtctggtaagacgatagttgccgctgtagctttgttt
gctgttatccgcactggtgcacaaggtgccttaatggtgccaacggaaatattggctgag
cagcattatcgttccttaacacgtttatttgagccatatggaataagtgtaggattatta
acaggaagtttaactgaaagaatacgaagagggatcataagctctttacaaacaggagaa
ttgcaaatacttatcgggacacatgctctgattcaggaggatgtttattttcacaattta
ggattggttgtcattgatgagcagcatcgatttggagtacaacaaagaagtatcctacgg
cgaaaaggtctgcatcctgatgtcctcacgatgacagcgacgcctataccacgtacactt
gcgattacggcttatggggatatggatgtatcctccttgcgagagttgcccaaaggcaga
aagccaattcgcacctactccgttaaccataacatgctagaacgagttctaggttttatt
agccgtgaagtgctggcaggcagacaagcttatctcatatgcccactgattgaagagtca
gaaaaggtagatgttcagaatgcaatggatcttcatgctcagctaacacagcattttccg
gattttcgtgttggtctattgcatgggcgtctgccaactgttgaaaaagatcatgttatg
cgtgagtttagtgagaataagatacaggtgttggtgtctacgacggttattgaggttgga
gtcgatgtgccaaacgccacaataatggtggtttatgacgcacagcgcttcggtttatct
cagctgcatcaattacgtggccgtgtaggtcggggggagcatgcttcctactgtatctta
attgcagaagctaaaagtgaagttagtaaagagcgactaaaggtaatgacagaaacgaat
gacggctttgagatagcaaggcgcgatttagagcttaggggtccaggggattactttggc
actaaacaaagtggtcttcctgagtttcgtttggcagatctagttagtgattttgaagta
ttagagcttgctcgtgatgatgtagctgaactgctcatgcgaacggatttttggaccggg
ctggaataccttgctttccgtcaattcctccagcgcgagcaaatatttggtgagggtttg
attgactag

DBGET integrated database retrieval system