KEGG   Paenibacillus psychroresistens: EHS13_19660
Entry
EHS13_19660       CDS       T06328                                 

Gene name
priA
Definition
(GenBank) primosomal protein N'
  KO
K04066  primosomal protein N' (replication factor Y) (superfamily II helicase) [EC:3.6.4.-]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    EHS13_19660 (priA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_19660 (priA)
Enzymes [BR:ppsc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     EHS13_19660 (priA)
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     EHS13_19660 (priA)
SSDB
Motif
Pfam: PriA_3primeBD PriA_C DEAD ResIII PriA_CRR Helicase_C PIF1 TIR DUF2075 T2SSE AAA_30 AAA_19 DAP3 Flavi_DEAD HTH_11 AAA_16 TrwB_AAD_bind Zot ATPase_2 AAA_22 HTH_Crp_2 zinc-ribbons_6 Herpes_ori_bp zf-ISL3
Other DBs
NCBI-ProteinID: QGQ96943
UniProt: A0A6B8RN28
LinkDB
Position
complement(4340789..4343293)
AA seq 834 aa
MFAKVIVDVPAKQTNRPFDYKIPDVLLEWVEVGSRVAVSFGPRTLQGFVVEVFEQSDYEA
SKIKSIEHVLDLEPPLTPELVELAHWISETYLCHEITALQVMIPGALKAKYERQLSWSPL
REEEEALLSFPEQNQLIAHIKNKGSVTFEALLAIFPEQGPWIKQLLRTGFLIESQIVKDR
MAKKKVLTIFPPTDLSQLASQMEQLSDKAKRQKEILQFLLENSQPIPLTELMLKLDVGAS
AVKSLADKGWVELKEIEVYRDPYANRSFPRTQPLLFTEEQQQVFNPISEAVRASRHQVFL
LHGVTGSGKTEVYLQSIQQCLDQDKEAIVLVPEISLTPQMVERFKGRFGDKVAVLHSRLS
QGERYDEWRKISLKQVMVVIGARSAVFAPFTKLGLIIIDEEHEASYKQEESPKYHARDVA
IERARRQNASVILGSATPSLESYYQAIGTGIPNEDSNYKLLTMAERVQGRPMPPVHIVDM
REELKEGNRSMFSRGLYKAIEERLNKKEQTVLLLNRRGYSTFVMCRTCGYTVGCPHCDIS
LTYHQNSKRLRCHYCGYTEPQPHECPSCKSEHIRYFGTGTQKVEDELSKLFPGIRVIRMD
VDTTTEKGSHEKWLNLFRDRKADVLLGTQMVAKGLDFPDVTLVGVIAADTVLNLPDFRAG
ERTFQLLTQVAGRAGRHQLPGEVFIQTYTPEHYSIQSASQHDYHAFIDTELDLRHSRGYP
PYYRLILVTLSHEQLALLVRTAESYVSRIKELAREAGIIMYTGNSNQVPELDIMGPVASP
IPRIKDRYRFQCMLKYRGEAHISNLVRKATAFFDDLCRQQNLQISVDVDPQLLQ
NT seq 2505 nt   +upstreamnt  +downstreamnt
atgttcgcgaaggttatagtggatgtaccagccaaacaaacaaatcgtccatttgattat
aagatcccggatgtattgttggagtgggttgaggtaggcagcagagttgcggtttctttt
ggaccacgaaccttgcaaggctttgtagtagaagtttttgaacaatccgactatgaagct
tctaagataaaatcaattgagcatgtattggatctggagcccccactaactccagagctt
gttgaattggcgcactggattagtgagacctatctttgccatgaaatcacagccctgcag
gtaatgattccaggtgcattgaaagccaaatatgaacggcagctatcttggagcccgctt
agggaagaggaagaagctttattatcttttccagaacaaaatcaactcattgctcatata
aaaaataaaggcagtgtgacttttgaagcgttgttagccatctttccagagcaaggacct
tggataaaacaattgctccgtacaggattccttattgaatctcaaattgtcaaagaccgc
atggctaagaaaaaagttttaacgattttcccgccaacggatttatcacagcttgcctcc
cagatggagcagttgagcgataaagctaaacgtcaaaaagaaattctgcaattcctgtta
gaaaattcacagcctattcctttaacggagttgatgttgaagcttgatgttggagctagt
gcggtcaaaagcctggcagataaaggctgggtggagcttaaggagattgaggtttatcgc
gatccttatgctaaccgcagctttcccagaacgcagcccttgctatttacggaagagcag
cagcaggtttttaatccgataagtgaagctgtaagagctagtcggcatcaggtatttctc
ttgcatggcgtaacgggcagtggtaaaacagaagtatacctgcaatcgattcaacaatgc
ttggatcaagataaagaagcgattgtactcgttccggaaatctccttaactccccaaatg
gtcgaacgctttaaaggtcggtttggagataaagtagcggtattgcatagccgattgtca
caaggcgagagatatgatgaatggcgtaaaatctccttgaagcaagtcatggtggtaatc
ggagcaagatcagctgtatttgcaccttttacaaagctaggtctgattattattgatgaa
gaacacgaagcttcttacaaacaagaagaaagccccaaatatcatgcccgcgatgtcgcg
atagaacgtgccagaaggcagaatgcatcggttattctaggctcggctactccttcttta
gaaagctattaccaagcgattggtacagggattcctaacgaagacagcaattataaacta
ttgacaatggccgaacgagtacaaggaagaccaatgccgcctgtgcacattgttgatatg
cgagaagagctgaaggaaggcaatcgttcgatgtttagccgcgggttgtataaagcgatc
gaagaacggttaaacaagaaagaacaaaccgtgcttttgttaaatcggcgtggatattct
acttttgtgatgtgtcgcacttgtggatacacggtaggctgcccgcattgtgatatttca
ttgacttatcatcagaacagcaagcgattgcgctgccattattgtgggtacaccgagcct
cagcctcatgaatgcccaagctgcaaaagtgagcatatccgttattttgggacaggaact
cagaaggtagaggatgaattaagcaagctgtttccgggtattcgagtcatccgaatggat
gtggatacaacaacggaaaagggctcgcatgaaaaatggttgaatttattccgcgatcga
aaagcagatgtattgttaggtacacaaatggtcgctaagggcttggattttcctgatgtg
actttagttggcgttattgctgcagatacggtattaaatttaccagatttccgtgcaggg
gaacgaacatttcaattgttaactcaggttgcaggtcgagcaggaagacatcagctgcct
ggcgaagtatttatccaaacctatactcccgagcattacagcatccaaagtgccagccag
catgattaccatgcttttattgatacagagcttgatttgcgtcattcccgtggatatcca
ccttattatcgtttgattcttgttacactttcacatgagcagcttgctttgcttgttaga
acagcagaatcctatgtgagccgaattaaggaattagcgagagaagctgggattattatg
tatactggcaattctaatcaggtacctgagttagatattatgggaccagtagcttcaccg
attccacgaatcaaagatagatatcggttccaatgcatgctaaaatatcggggagaggca
catatttcgaatctcgtcagaaaagctacagcatttttcgatgacctgtgccgccagcaa
aatttacagattagtgtagatgtcgatccgcaattgttacaataa

DBGET integrated database retrieval system