KEGG   Paenibacillus psychroresistens: EHS13_20200
Entry
EHS13_20200       CDS       T06328                                 

Definition
(GenBank) Ku protein
  KO
K10979  DNA end-binding protein Ku
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    EHS13_20200
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_20200
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     EHS13_20200
SSDB
Motif
Pfam: Ku SpmSyn_N
Other DBs
NCBI-ProteinID: QGQ97041
UniProt: A0A6B8RKW8
LinkDB
Position
complement(4431271..4432116)
AA seq 281 aa
MHTVWKGAISFGLVHIPVKMHSAIEDKDITMKYIHKECGTNLSYIKSCKACEKEVSGEDI
VKGYEYENGKFVIFNKDEIEEILPENTKEIKILDFVDLHEIDPVYFQKTYYLSPGDTSAK
AYYLLYEAIRTKGKIGICKVIIRSKSSLAALRIIDHCLVMETIYYPDEIRPVQQVPNLKL
NMEVSEMELKMAHMLIDHLSKPFDPNNYQDDYREELTSLIQKKINGEEFHVSRVEAKSNI
LDLMSALQASLSSLKPKNEVGKPKRKTTRKKKESAVVEGTG
NT seq 846 nt   +upstreamnt  +downstreamnt
atgcatacagtttggaagggcgctatatcatttggtttggtacatatacccgtgaagatg
cattcggcaatagaggataaggatataacaatgaaatacatccataaagaatgcggcacc
aacctttcttatataaaatcctgtaaagcttgtgaaaaagaagtttcaggtgaagatatt
gtgaaaggttacgaatatgaaaacgggaagtttgtgatttttaataaggacgaaattgaa
gagattctacctgaaaatactaaagaaataaaaattttggatttcgttgatcttcatgaa
atagatccggtttattttcagaaaacatactatttatccccaggcgatacgagcgcaaaa
gcatattatttactttacgaggcaattagaactaaggggaaaataggtatttgcaaggtg
attattcgctcgaaaagcagcctagctgcacttagaattattgaccattgcttagttatg
gaaaccatttattatccggatgagataagacctgttcaacaagtaccaaatttgaaactc
aatatggaagttagtgaaatggaattgaaaatggcacatatgttgatcgaccatttgtca
aaaccatttgatccgaataattaccaagatgattatcgcgaggaattaacctcattaatt
caaaagaaaataaatggcgaagagttccacgtttctagagttgaagcaaaatcaaatatc
ttggatttaatgtctgcactgcaagcaagcctgagcagccttaagccaaaaaatgaagta
ggtaaacctaaacgaaaaacaaccagaaagaaaaaagagtctgctgttgtagaaggaaca
ggttaa

DBGET integrated database retrieval system