KEGG   Paenibacillus psychroresistens: EHS13_20460
Entry
EHS13_20460       CDS       T06328                                 

Gene name
recN
Definition
(GenBank) DNA repair protein RecN
  KO
K03631  DNA repair protein RecN (Recombination protein N)
Organism
ppsc  Paenibacillus psychroresistens
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_20460 (recN)
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     EHS13_20460 (recN)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    EHS13_20460 (recN)
SSDB
Motif
Pfam: SMC_N AAA_23 AAA_21 AAA_29 AAA_22 RsgA_GTPase DUF3791 ABC_tran
Other DBs
NCBI-ProteinID: QGQ97091
UniProt: A0A6B8RL22
LinkDB
Position
complement(4469718..4471427)
AA seq 569 aa
MLVHLSIRNLAVIESVQLSFRHGFQVLTGETGAGKSIVIDALTLIAGGRGSSEWVRYGTD
KAEIEALFEIVSDHPVWAVLERIGITAASEESLIIRRDLSAQGKSTSRINGQLVNLTMLR
EVGEWLVNIHGQHEHQSLLKAEEHMSWLDAFGGVAIEGMKQQYQASYDRYIGLNKQLAAL
EETSKQALQMRDLYLFQVDEITEADLKPAEDELLEEEKRKLSYAEKLFQNSSEAYDAIHA
NKSGLDAINKSIQRLQEIAGLDPSQLKPLLDQVQSAFYQLEDAAFQLRDYRDQIEFNPKR
IDQIETRLHLIASFRRKYGVNVMEILQYLHKIQDELQLIENKDELLLQIQENANAELKIA
TSLAYTLSKQRQKSATILASEIERELRDLQMERTRFSVRIERLEDKLTRNGCDQVEFLIS
ANPGEPLRPMSKIASGGELSRIMLAMKSIFAKVDRIPVLVFDEVDTGVSGRAAQAIAEKL
SVLSGACQVFSITHLPQVACMADAHYLIQKIVEGERTFTQVEDLNVQGQVNELARMLGGV
EITETTLEHAQEMLRMANQKKKDIQNVKV
NT seq 1710 nt   +upstreamnt  +downstreamnt
atgttagtgcatttaagtattcggaatttagctgttattgaatcggttcagctttctttt
cgccatggatttcaagtactgactggggaaacaggtgcaggtaaatcaattgtgattgat
gccttaactttaattgcaggtggacgcggttcttcggaatgggttagatatggaacggat
aaagcggaaatcgaagcgttgtttgaaattgtcagcgatcatcccgtatgggcagttctt
gaacgaataggtatcacagcagcctccgaagaaagcttaattattagacgggatttatcg
gcacaagggaaaagcacgagtcgaattaatggacagctggttaatttaacgatgctgcgt
gaggttggcgaatggttagtcaatattcatggccagcatgagcatcaatctttgttgaaa
gcggaagagcacatgagttggttggatgcttttggcggtgtagcgatagaggggatgaaa
cagcaatatcaagcctcttatgatcgttatattggtttaaataaacagcttgctgctctg
gaagaaaccagcaagcaagccctgcaaatgcgtgatttatatttgtttcaggtagatgaa
ataacagaagcagatttaaaaccagcggaggatgaattattagaggaagaaaagcgcaaa
ctaagctatgcagagaaattatttcagaattcatctgaagcctatgatgctattcatgct
aataaaagcggattagatgcaatcaataaatcgattcaacgcttgcaggagatcgcaggt
ttagatccaagccaattaaagccgttgctggatcaggtgcagtctgcattttaccaattg
gaagatgcagcttttcagctgagagattaccgggatcaaattgaatttaacccaaaacga
attgatcaaatcgaaacacgcttacatttaattgcttcttttcgccgcaaatatggtgtg
aatgtaatggagattctacagtacttacataagatacaagatgagcttcaattaattgag
aataaagatgagctgctgctgcagattcaagaaaacgcgaatgctgaattaaaaatcgcc
actagcctggcttataccttatccaaacaacgccagaaaagcgcaacaatcctagcatca
gaaatcgagcgagaattacgtgatttgcagatggaacggacgcgattctcagtacgcatt
gagcggctggaggacaagctgacacgtaatggctgcgatcaggtagaattccttatctcg
gctaatccaggagagcccttacgcccaatgagtaaaattgcttctggaggagaactctca
cgaatcatgcttgcgatgaaatcgatctttgctaaggttgatcggataccagtccttgtc
tttgatgaggttgatacaggagtcagcggacgcgcagcacaagcaattgccgagaagctt
tctgtcttgtcgggcgcttgtcaggttttctcgattactcatttgccacaggttgcttgt
atggcggatgcccattatttaattcagaagattgtggaaggcgagagaacgtttacgcaa
gtagaggacttaaatgtacaaggccaagtgaatgagcttgctaggatgcttggaggcgtt
gagattacagaaactactcttgagcatgcacaggaaatgctgcgaatggcgaatcaaaag
aaaaaagatattcagaatgttaaggtatga

DBGET integrated database retrieval system