KEGG   Paenibacillus psychroresistens: EHS13_20515
Entry
EHS13_20515       CDS       T06328                                 

Definition
(GenBank) exodeoxyribonuclease VII large subunit
  KO
K03601  exodeoxyribonuclease VII large subunit [EC:3.1.11.6]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    EHS13_20515
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_20515
Enzymes [BR:ppsc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.6  exodeoxyribonuclease VII
     EHS13_20515
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA exonucleases
     EHS13_20515
SSDB
Motif
Pfam: Exonuc_VII_L tRNA_anti_2 tRNA_anti-codon
Other DBs
NCBI-ProteinID: QGQ97100
UniProt: A0A6B8RLB0
LinkDB
Position
complement(4481259..4482620)
AA seq 453 aa
MKREAILSIKDLNKYIKAVLESEDLLQDVWVRGEISNFTHHSSGHMYFTLKDTDSRIKTI
MFAKQNQRLPFMPREGTRVIARGNISVYERDGQYQFYVTEMQPDGIGGLYMAYEQLKQKL
EAEGLFAASSKKQIPRFPKAIGIITSPTGAAVRDIIITLQRRFPTIPILLYPVLVQGTQA
APAIVKAIKEMNARKEVDLLIVGRGGGSLEELWAFNEEAVARSIFASVIPIISAVGHETD
FTIADFAADLRAATPTAAAELAVPHHMELRQQMAQLTNRLQRGLFQELQAKRERLERVKR
SPYLLNPRKQLIQPTERLDRLTEQLRYKIQNKVTRAEQKKLKLEQRLSGFNPQEQVLYTK
RRVGQAERQLLLAMQTLLKSHQYRWNTQLKQLDALSPLKVMQRGYSLVYDENKKNLIKSV
TQVQLGDIVNITLKDGRMDCHIWAVEEITNGQD
NT seq 1362 nt   +upstreamnt  +downstreamnt
atgaaacgtgaagcgattctctccattaaggatcttaataaatatataaaagcggttcta
gagagtgaagatttattgcaggatgtttgggtacgcggggagatttctaattttacccat
cattccagtgggcatatgtattttaccttaaaagatactgacagccgcatcaagacgatt
atgtttgctaaacaaaatcaacgattgccgtttatgccgcgagagggaacccgagttatt
gctcgagggaatatctccgtatatgagcgggatggacaatatcaattctatgtgactgaa
atgcagccagatggcattggcggcttgtatatggcttatgagcaattaaagcaaaagctg
gaagcggaaggattattcgctgcaagcagtaaaaaacagattccacgctttcccaaagca
atcggcattattacttcccctacgggtgcagcagttcgagacatcattataaccttgcag
cgcaggtttccgacgatacctattctactatatccagtcttggtacaaggcacacaagcg
gcacctgcgatagttaaagcgattaaagaaatgaatgctagaaaagaagtcgatctttta
attgttggacgcggcggcggatcactagaagagctttgggcttttaatgaagaggccgtt
gcgcgcagtatatttgcatccgtgattccgattatttcagcggttggccatgaaacggat
tttacgattgctgattttgcagcggatctacgagcggctactcctacagcggcagcagaa
ttggctgtaccgcatcacatggagctgaggcagcagatggctcagcttacgaatcgtttg
cagcgtgggctattccaggagctgcaagcaaagcgtgagcgcttagagcgggtaaagcga
tctccatatctgcttaatccacgtaaacagttgattcagcctacagaacggctcgatcgt
ttgacggagcagctgcggtataagattcagaataaggtgacccgtgcagagcagaaaaag
ctgaagctggaacagcgattaagtggcttcaatccgcaagagcaggttctatatactaag
cgaagagtgggtcaagcggagcgacaattgctgcttgccatgcaaacattgctgaaatca
catcaatatcgctggaatacacagctgaagcaattggatgcattaagtcctttgaaggtt
atgcagcgtgggtacagtcttgtatatgacgagaataagaaaaacctaattaaatctgta
acccaagtgcaattaggtgacatagtgaacattactttaaaagatggtcgaatggattgt
catatttgggcggtggaggagattacgaatggccaagattaa

DBGET integrated database retrieval system