KEGG   Paenibacillus psychroresistens: EHS13_22225
Entry
EHS13_22225       CDS       T06328                                 

Definition
(GenBank) DNA repair exonuclease
  KO
K03547  DNA repair protein SbcD/Mre11
Organism
ppsc  Paenibacillus psychroresistens
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_22225
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     EHS13_22225
SSDB
Motif
Pfam: Metallophos Metallophos_2
Other DBs
NCBI-ProteinID: QGQ97407
UniProt: A0A6B8RNI6
LinkDB
Position
complement(4871481..4872854)
AA seq 457 aa
MKAFRFIHAADLHLDSPFVGMAELPLGIRESLRQSTFKAMANLVELAIQQSVDFVLISGD
VYDLADRSLRAQIRFQKALQRLSAAGIASYIVHGNHDPEDGRAARLNWPTLAYFFSAREV
ESLPVKLEGKGTVAQIYGISYATAAVTENLAKRITEKYQQNIGSHSDLFRIGLLHTNVEG
NQAHANYAPCSIQDLLGSGMDYWALGHVHTRQVLNTEPAIVYPGNLQGRSIRETEAKGCY
IVDVSEFGEAKLTFHALDAIRWQQRSISIQGIHTEQELKERFELELEKAREDAAGRASII
RITLTDRGPIHVTLQKKSVLDELITELREDEVRRLENLGSLNVGLIELDGIVETADPLTG
NYVWIESVQVHSGLEVDKNLLLDQESFLGDLLRLSESILTDEALLAAFCAETLDPLFTQS
KAAKYLSGVGREEHKAWVKAAQELAIDFLAADARWDE
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgaaagcctttcgatttattcatgcggctgatctgcatttggatagcccttttgtcgga
atggctgaattgccacttgggattcgcgaatcattgcggcaatcgacatttaaggcaatg
gcgaatttggtagagctggcaattcagcaaagcgttgattttgtcttaataagcggagat
gtttacgatttagcggatcgttcgctgcgtgcacaaattcgctttcaaaaagcgctgcag
cgtttaagtgcagcgggtattgcaagctatattgtacatggaaaccatgatcctgaggat
gggcgagcggctaggctgaattggccaacgctagcttattttttttctgccagagaggtg
gaatcattgccagttaagcttgaaggcaaaggtactgttgcgcagatatatgggatttcg
tatgcaactgcagcagtgacagagaatttagctaaacgcattactgaaaaatatcagcaa
aatatagggagtcattcggatttgtttcgaattgggcttttacatacaaatgtcgaagga
aatcaagctcatgccaattatgcaccttgctcgattcaagatttattaggaagtggaatg
gactattgggccttggggcatgttcatactcggcaagtgctgaatacggagccagctatt
gtttaccctggcaatctacagggacggagtatacgtgaaacggaggcaaaaggttgttat
atcgtggatgtatcggaattcggtgaagctaaactgacattccatgccttggatgctatt
cgttggcagcagcgctctatttccattcaaggcattcataccgagcaggagctgaaggaa
cggtttgagcttgaattggagaaagctcgtgaggacgctgccggtcgtgcgtccattata
cggataaccttaacggatcgtggaccgattcatgttacgctgcaaaaaaagagtgtgctg
gatgagctcattactgaattgcgtgaggatgaagttagacggcttgaaaacttgggtagt
ttgaatgtgggattaatagaactagatgggatagtagaaacggctgatccgctaacgggg
aattatgtatggatcgaatctgtacaagtgcattctgggttagaggtagataaaaatttg
ctgcttgaccaagaaagctttctcggtgatcttctgcgtttatcggagtccattctcacg
gatgaggctttattggctgcattttgtgcggagactttggatcccttgtttacgcaaagt
aaagcggctaagtatttaagcggagtagggcgagaggaacataaagcttgggtgaaagcc
gcacaagagctggctatcgactttctggccgcggatgcgaggtgggatgaatga

DBGET integrated database retrieval system