KEGG   Paenibacillus psychroresistens: EHS13_22335
Entry
EHS13_22335       CDS       T06328                                 

Definition
(GenBank) DNA polymerase IV
  KO
K02346  DNA polymerase IV [EC:2.7.7.7]
Organism
ppsc  Paenibacillus psychroresistens
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_22335
Enzymes [BR:ppsc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     EHS13_22335
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    EHS13_22335
SSDB
Motif
Pfam: IMS IMS_C IMS_HHH DUF1805
Other DBs
NCBI-ProteinID: QGQ97429
UniProt: A0A6B8RN09
LinkDB
Position
complement(4895539..4896834)
AA seq 431 aa
MKPSAEFYPKDGRVILHTDMNAFYCSVHEAVEPDKYRGKPIAVAGSVELRKGIVVTSSYV
ARSQGVKTGMQVREAFKVCPELIIIQPDFEQYRLFSKAFMQIAYSYSPLIEAMSIDECYL
DITGSKLFGSPLEIAQALQTRIRVELDLPCSIGIAPNKLLAKMASDMKKPNGISILRRRD
VPRLLWDKPCAYLFGIGRQTGDKLSVLNIQTIGQLAAAEESFLIKHFGVIGSWLKQAANG
IDHSPVNPLNEASKSIGHTTTLPQNLTEKTAIDRVFLNLADQVARRLRRQHLTAGTIQIT
IRDPEMKTITRSFTPAAPTENADDIYHEACRLFHLHWKSGKAVRLLGITLQSLQDKDKSA
MQLDLFDFEKQPKREQLNLAMDRIRDKYGESALLTAGMISNDPSALIRNHKVRGTSLQMD
HLKISNFDEES
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgaagccaagcgctgagttctatcccaaggatggtagagtcattctgcacacagatatg
aatgcattttactgttcggtacatgaagcagtcgagcctgataagtatcgaggcaagcca
atagctgttgcagggagcgtagagctgcgtaaagggatcgtagtgacttcctcctatgta
gctcgttcccaaggggttaagacgggtatgcaggtgcgagaggcttttaaagtctgtcca
gagcttatcatcattcaacctgattttgagcagtatcgcttgttctccaaagcctttatg
caaattgcttatagttattcacctttaatagaggctatgtctattgacgaatgttattta
gatattaccggttcaaagctttttggctccccattagaaattgctcaagctctgcaaacg
agaattcgtgtagagcttgatttgccatgttcaattggaattgcacctaataaactacta
gccaaaatggcttctgatatgaaaaaaccaaacgggatttctattttacgaagaagagat
gttccgcggctgctatgggacaaaccatgtgcctatttattcgggatcggccgacaaaca
ggagacaagctgagtgttctgaatattcaaactatcggacagctggctgctgctgaggaa
tcctttttgatcaaacattttggtgtgattggcagctggctgaagcaggctgctaatggg
attgaccattccccggttaatccgctgaatgaagcaagcaagtcgatcggacatacgacg
acattgccgcaaaatttaacagagaaaaccgctattgatcgcgtttttctgaatttggca
gatcaggttgcgagaagattgcgaagacagcatttaacggctggcactattcagattact
atccgggatccggaaatgaagaccattacacgttctttcactccagcagctccgacagag
aatgcagatgatatttaccatgaggcatgccgtttatttcatttgcattggaagtctgga
aaagctgtgcgattattgggaatcacactgcaaagtctccaggataaagataaatctgcg
atgcagttggatttgtttgattttgagaagcagcctaagagagagcaattaaacctagcc
atggatcgcattcgagataaatatggggaaagcgccttgcttacagcaggtatgatcagt
aacgatccatccgctttaattcgtaatcacaaggtacgaggtacctcattacaaatggat
catctcaaaataagtaattttgatgaagagtcataa

DBGET integrated database retrieval system