KEGG   Paenibacillus psychroresistens: EHS13_22445
Entry
EHS13_22445       CDS       T06328                                 

Definition
(GenBank) DEAD/DEAH box helicase
  KO
K05592  ATP-dependent RNA helicase DeaD [EC:3.6.4.13]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    EHS13_22445
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ppsc03019]
    EHS13_22445
   03009 Ribosome biogenesis [BR:ppsc03009]
    EHS13_22445
Enzymes [BR:ppsc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     EHS13_22445
Messenger RNA biogenesis [BR:ppsc03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Helicases
     EHS13_22445
Ribosome biogenesis [BR:ppsc03009]
 Prokaryotic type
  rRNA helicases
   EHS13_22445
SSDB
Motif
Pfam: DEAD Helicase_C ResIII AAA_19 CMS1 Helicase_RecD AAA_22
Other DBs
NCBI-ProteinID: QGQ97448
UniProt: A0A6B8RQ76
LinkDB
Position
complement(4916723..4918321)
AA seq 532 aa
MKTFNEFGLEPKVLQAITELGYEESTPIQEATIPLAMEGRDLIGQAQTGTGKTAAFGIPL
IHKIQVKEEKIVALIMCPTRELAIQVAEDIEKLGRFKGIRSLPIYGGQDIVKQIRSLKKK
PQIIIGTPGRLLDHINRKTIKLEDVQTVILDEADEMLDMGFMEDIQSILKLVPATRHTML
FSATMPMNIQKLAQQFLRNPEHVSVMSKNITAPLIHQAYIEVHEKQKFEALSRLIDMEAP
DLAIIFGRTKRRVDELSEALQKRGYSADGLHGDLSQNQRDAVMRKFRDGSIDVLVATDVA
ARGLDVSGVSHVINFDMPQDPESYVHRIGRTGRAGKEGKALTFVTPREIDHLHFIEKVTK
HKIDKKPLPSMAEAIEGKQKATAERILDAVQNEKGHEFRGLAIQLLEQYDSVNLLSCALQ
LLTGDSKEVSVELTPEDPLRAKKRHGDIRSSGRRPSAPYSSGSSSGGSSGGRRYDRSSGS
GGSSTGGSSSRPPRKEGGGWEGRDSRPGNRDYKGTNRDANKSPRSKEDFVNK
NT seq 1599 nt   +upstreamnt  +downstreamnt
ttgaaaacatttaacgagtttggccttgaacctaaggtactacaagcaattactgaattg
gggtacgaggaatcaacacccattcaggaggctacaattcctttggctatggaaggtaga
gatttaatcggtcaagcccaaaccggaacgggtaagacggcggcattcggtattcctcta
atccacaaaattcaagttaaagaagagaaaatcgttgcacttatcatgtgtcctacacgt
gaattggcgattcaagttgcagaagatatcgagaaattgggacgtttcaaggggattcgt
tcattgccgatttatggcggccaagatattgtgaagcaaattcgctctttgaagaaaaag
ccgcaaattatcattggaacaccaggacgtttgttggatcatattaaccgcaagacgatt
aagctggaagatgtacaaaccgttattctagatgaagcggatgaaatgcttgatatgggc
tttatggaagacattcaatccattttgaagcttgtacctgcaacacgccacaccatgttg
ttctcggcaacaatgccaatgaacatccaaaagcttgcccaacaatttttacgcaaccct
gagcatgtttcagttatgtcgaagaatatcactgcaccattgatacatcaggcatatatt
gaagttcatgaaaaacaaaaattcgaagcgcttagtcgtttaattgatatggaagctccg
gatttagcgattatttttggacgtacaaaacgtcgggtagatgaattatcagaagcatta
caaaaacgtggttattccgctgatggtctacatggcgatttatcacaaaaccaacgtgat
gctgtaatgcgtaaattccgtgatggcagcatcgatgttctagttgcaactgatgtagca
gcaagaggcttggatgtttcaggcgtttcacatgttattaactttgatatgccgcaagat
ccagaaagctatgtacacagaattggtcgtacaggacgcgctggtaaagaaggtaaagcc
ttaacatttgtaacacctcgtgaaattgatcatttgcattttatcgagaaagttactaag
cataaaattgataaaaaacctttgccaagcatggctgaagccattgaaggcaaacaaaaa
gcaacagctgaaagaattcttgacgctgtacagaatgaaaaaggccatgaattcagaggg
cttgctatccaattgttagagcaatatgactctgtaaatttattgtcatgtgctttacaa
ttattaacaggtgacagcaaggaagtttcagtggagttaactccggaagatccgttacgc
gctaaaaagcgtcatggcgatattcgttcatcaggtagacgcccaagtgctccttattcc
tcaggcagctcatcaggtggatcttcaggtggaagacgttatgatcgcagctcaggatca
ggtggttcaagcactggaggttcaagctcacgcccgccacgtaaagaaggcggcggctgg
gaaggtcgcgatagcagaccaggcaatagagattataaaggtactaaccgggatgccaat
aaatccccgcgcagtaaagaagattttgtaaataaatga

DBGET integrated database retrieval system