KEGG   Paenibacillus psychroresistens: EHS13_23155
Entry
EHS13_23155       CDS       T06328                                 

Gene name
mutM
Definition
(GenBank) DNA-formamidopyrimidine glycosylase
  KO
K10563  formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    EHS13_23155 (mutM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_23155 (mutM)
Enzymes [BR:ppsc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     EHS13_23155 (mutM)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     EHS13_23155 (mutM)
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     EHS13_23155 (mutM)
SSDB
Motif
Pfam: Fapy_DNA_glyco H2TH zf-FPG_IleRS FbpA Zn-ribbon_8 Zn_Tnp_IS91
Other DBs
NCBI-ProteinID: QGQ97578
UniProt: A0A6B8RQL0
LinkDB
Position
complement(5057368..5058204)
AA seq 278 aa
MPELPEVETVVRTLNQLVGGKRIQRVEVLLNRIIQRPVEPEQFTAALENQLIHRIERRGK
FIRFILDEIVMVSHLRMEGRYGLHQEDEPIEKHTHVVFYFTDGTQLRYKDVRQFGTMHLF
ATGDELIMKPLHKLGLEPLDESFTYEVFHARIAHRSTKIKPLLLNQEFIVGLGNIYVDES
LYRAGIFSERETNKLTELELRKLHTAIVVTLQAAVEAGGSSIKSYVNGQGEMGMFQQQLQ
VYGRKGEPCEECGSLIEKIVVGGRGTHYCPQCQPKEPS
NT seq 837 nt   +upstreamnt  +downstreamnt
atgcctgaattaccggaagtagaaaccgtagttcgaaccttaaaccaactcgttggcggc
aaaagaattcaacgtgtcgaggtattactaaatcggatcattcaacgtcctgttgagccc
gagcaatttacagcagcacttgagaatcaattaatccatcgaatagagcgtagaggcaaa
tttattcgattcattctcgatgaaattgtaatggtatcccatctaaggatggaaggccgt
tatggcttacaccaagaggatgaacccatagagaagcatacgcatgttgtgttttatttt
acagacggtactcagctgcgctataaggatgtacggcaatttggaaccatgcatttattc
gcaacaggcgatgaattaattatgaagcccttgcataagcttggactggaaccactggat
gagtcgtttacttatgaagtttttcatgctcgaattgctcatcgttccactaagattaaa
ccgcttttgctgaatcaagaatttattgttggattaggtaatatttacgtggatgagtca
ctatatagagcagggatcttctcagaacgagaaacgaataagctaaccgagttagagctg
cgcaagctgcacactgcgattgttgtgactttacaagcagcagtagaagcaggaggctcc
tcgatcaaatcctatgtaaatggacaaggtgaaatggggatgtttcagcagcaattgcag
gtttatggacgtaaaggggaaccttgtgaagaatgcggcagcttgatcgagaaaattgtg
gtaggtggacggggaacccattattgtcctcaatgccagcctaaggagccgagctaa

DBGET integrated database retrieval system