KEGG   Paenibacillus psychroresistens: EHS13_23990
Entry
EHS13_23990       CDS       T06328                                 

Definition
(GenBank) NUDIX domain-containing protein
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
ppsc  Paenibacillus psychroresistens
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_23990
Enzymes [BR:ppsc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     EHS13_23990
DNA repair and recombination proteins [BR:ppsc03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    EHS13_23990
 Prokaryotic type
    EHS13_23990
SSDB
Motif
Pfam: NUDIX
Other DBs
NCBI-ProteinID: QGQ97728
UniProt: A0A6B8RR23
LinkDB
Position
complement(5248867..5249379)
AA seq 170 aa
MELILNFVINGVKKMGSNFHHLARGIIINNDKILLAHAIGHKNTFFPGGHIEFGESAPEA
LKREIEEEIGLSCYIEGYLGLVEHKWEKDKELHCEINQAFKVKVPEMDVLKSPTSRESHI
EFYWVSVNELKKHNLQPYPFQKLIPKFVSGDESVWWESTLNYELDEDNIG
NT seq 513 nt   +upstreamnt  +downstreamnt
atggaattaatattaaatttcgtaattaatggagtgaaaaaaatgggttcaaattttcat
catttggcaaggggtattattatcaataatgataagattttgctggctcatgcaataggt
cataaaaatactttttttcctggaggtcatattgaatttggtgaaagtgcgccagaagca
ttaaaacgggaaatagaagaagaaattggtttgtcttgttacatagaaggatacttaggc
ttggtggagcataagtgggaaaaagataaggaattacattgtgaaattaaccaagctttc
aaagtgaaagtacctgaaatggatgtgttaaaatctccgacatctcgtgagtctcatata
gaattttattgggtgtctgtaaatgaacttaaaaaacacaatttacaaccctatcctttc
caaaaacttattccaaagtttgttagtggtgacgaatcagtatggtgggaaagtacgtta
aactacgaattagatgaagataatattggatga

DBGET integrated database retrieval system