KEGG   Paenibacillus psychroresistens: EHS13_25335
Entry
EHS13_25335       CDS       T06328                                 

Definition
(GenBank) endonuclease MutS2
  KO
K07456  DNA mismatch repair protein MutS2
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    EHS13_25335
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_25335
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     EHS13_25335
SSDB
Motif
Pfam: MutS_V Smr MutS_III Peptidase_U57 AAA_22 ERM
Other DBs
NCBI-ProteinID: QGQ97978
UniProt: A0A6B8RRU1
LinkDB
Position
complement(5567229..5569595)
AA seq 788 aa
MNTKIIKTLEYGKILHTLSGYAATSLGKAWVEKLEPSPELTEVKQRLQATDEAAHVIRLK
GSAPFGGIRDVHASIRRSEIAGTLNPTELLDIANTMSGARRLQRFILNVHEDHPIPLLAK
LGNELTETKAVEEAIRYCIDDNAAVLDSASSELSKIRQELRNGESRAREKLDQMIRTPSI
QKMLQDSILTMRNDRYVIPVKQEYRGHFGGIIHDQSASGATLFIEPESVVVLNNKLRELK
LKEEREIEKILQMLTAQVAEVAEPMKINLIVLAELDFMFAKAGIAREMKAVLPIMNDRGF
LKLRKGRHPLIPHKSVVPLDLEIGNHYSTIIVTGPNTGGKTVSLKTVGLLSLMAMSGLFV
PAEEGSQLCVFDAIYADIGDEQSIEQNLSTFSSHMTNIINILRDMTPKSLVLLDEVGAGT
DPAEGSALAISILEDIHRKGSRMIATTHYSELKAYAYERSGIINASMEFDIQTLSPTYRL
LVGVPGRSNAFAIAERLGLDKTIIDHARGQVNEEDQRVETMIATLEENRLVAESERHIAE
QLRRDGEQLVRKLEQEQVKFELERAKLMEQAEKDAAQAVAKARVEADQIIADLRKLAMEE
RSSVKEHVLIEAKRRLDEAVPKLKDKNRSTQQAKKPKALQAGDDVIVSSIGQRGQIVEIV
SGTEAVVQLGMMKMKVALADLDTLGGGTASKKTVQHVVTGVKRTRDEHTRSELDLRGANL
DDSIIEVDRFLDESFLANLSQVYIIHGKGTGVLRSGIQDYMRKHRNVKSYRLGNYGEGGN
GVTVVELK
NT seq 2367 nt   +upstreamnt  +downstreamnt
gtgaatactaagattattaaaactttagaatacggtaagattttacatacactttctggc
tatgcggctacttcgttagggaaggcttgggttgagaagctagagccaagtccagagctt
acggaagttaagcaacgtttgcaagcgaccgatgaggccgcacatgtcattcggttaaaa
ggatcagcaccgtttggtggaatccgtgatgttcatgcatccatacgtcgatcagaaatt
gccgggacacttaatcccactgagctgcttgatattgcgaatacgatgagtggagcccgc
agattacagcggtttattcttaatgtccatgaggatcatccgattcccttattggccaag
cttggcaatgaattgaccgaaactaaggcagttgaagaagctattcgttattgtattgac
gataatgcagctgttttggatagcgcaagctcagagttaagtaagattcgtcaagaactg
cgtaatggggagtcacgggctcgtgaaaagctggatcaaatgattcgaaccccatccatt
caaaaaatgctgcaggatagtattcttactatgcgcaatgaccgttatgttattcctgtt
aaacaagaatatcggggtcattttggtgggattattcatgatcagtccgcatcaggggct
accttattcatcgagcctgaatctgtagtcgtgcttaataataaattacgcgagctcaag
ctcaaagaagaacgagaaattgagaaaatattgcaaatgctcacggcacaggtagctgaa
gtagcagaaccgatgaaaattaatcttatagtactggctgagctggatttcatgtttgcc
aaagcagggatagcacgtgagatgaaggcagtgctgcccattatgaacgatcgtggcttt
cttaagctgcgtaaaggcagacatccccttattccacataaatcggttgtcccgcttgat
ttggaaattggcaatcactattcgacaattatcgtaacaggacctaatacaggtggtaaa
accgtttctttgaaaacggtaggtttactaagtttgatggcgatgtctggtttattcgtg
cctgctgaggaaggaagtcagctttgtgtattcgacgcgatttatgcggatataggcgat
gagcaaagtatcgaacaaaacttaagtacattttccagtcatatgactaatattattaat
atcctacgcgacatgacgcctaaaagcttggtgctgctagacgaagtcggtgcgggaacg
gatccagcagaaggatcagctttggcgatctctatattagaagatatccatcgcaaggga
agccggatgattgctacgacccattatagtgagcttaaagcatacgcttatgagcgcagc
ggaatcattaatgccagtatggaatttgatattcaaacgttaagtcccacctaccgctta
ttggttggagtgcctgggcgcagcaatgcctttgcgattgcggagcgactcggtctcgac
aagacgatcatcgatcatgcccgcgggcaggttaacgaagaggaccaacgtgtagaaacg
atgattgcgacgctggaggagaacaggcttgtagcagagtcggaacgacatatcgctgag
cagctgcgtcgtgatggtgaacagctggttagaaagctggagcaggagcaagtcaagttt
gaactagagcgcgccaagctcatggagcaagcagagaaagatgcggctcaagcggttgct
aaggcaagagtcgaagcggaccaaatcatcgcagatttgcgcaagctggcaatggaagaa
cgcagctcagtcaaggagcatgtgcttatcgaagcgaagcgacgtttggatgaagccgtg
cctaagctgaaggataagaatcgttccacacagcaagcgaagaaaccaaaggcgcttcaa
gcaggtgacgatgtgattgtttcaagcatcggtcaaagaggccaaattgttgagatcgtt
agcggaacagaagcagttgttcagttaggtatgatgaaaatgaaagtagcattagctgat
ctagacaccttaggtggtggtacagcgtccaagaagactgttcagcatgtagtgacaggc
gtgaaacggactcgagatgagcatacacgttcagagctcgatttacgtggggctaatttg
gacgattcgattattgaagtcgatcgttttctggacgagtcttttctagccaatttaagt
caggtctatattattcatggtaagggtacaggtgtattgagatccgggattcaggattat
atgcgcaagcatcgcaatgtgaaaagctatcgtctaggcaactatggtgaaggcggtaat
ggagtcacagtagtggagcttaaataa

DBGET integrated database retrieval system