KEGG   Paenibacillus psychroresistens: EHS13_25465
Entry
EHS13_25465       CDS       T06328                                 

Definition
(GenBank) ribonucleotide-diphosphate reductase subunit beta
  KO
K00526  ribonucleoside-diphosphate reductase beta chain [EC:1.17.4.1]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc00230  Purine metabolism
ppsc00240  Pyrimidine metabolism
ppsc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    EHS13_25465
   00240 Pyrimidine metabolism
    EHS13_25465
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_25465
Enzymes [BR:ppsc01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     EHS13_25465
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    EHS13_25465
SSDB
Motif
Pfam: Ribonuc_red_sm Drf_GBD
Other DBs
NCBI-ProteinID: QGQ98001
UniProt: A0A6B8RNS2
LinkDB
Position
5596339..5597388
AA seq 349 aa
MDSNDKLTKKKLFNEHGDREWGKRRMIGGNTTNLIQLNNVKYEWATKMYRAMMNNFWIPE
EIPLAQDAKDYKLLTPTERSSYDKIISFLIFLDSLQTANLPNINEYITAPEVNLCLTVQT
FQEAVHSQSYSYILDSVCSSEAREDIYNQWREDKHLLQRNRFITDLYEKFIDEPSTTNLL
RTIMANYILEGIYFYSGFSFFYALGRQGKMLGTVSEIKYIQRDELTHLALFQGIFREIRT
ENPELFTPDLVESLRDMMRTAVEHEIAWGLYITQNNIAGLSDTVITQYIQYLSNDRLKKL
NLEILYPDIVEHPMKWVETFSNMNGMKTDFFEQKVTNYSKSSGMDWGDI
NT seq 1050 nt   +upstreamnt  +downstreamnt
atggattcaaatgataaactaacaaagaagaaattgttcaatgaacatggggaccgtgaa
tggggcaagcgcagaatgatcggtggcaacacaacaaaccttattcaactgaacaatgtt
aaatatgaatgggcaactaagatgtaccgcgcaatgatgaataacttctggattccagaa
gaaatccctctagctcaggatgctaaggattacaagctgttaacacctactgagcgttcc
agctatgataaaattattagctttctaatttttctagattccttgcaaacggctaatttg
cctaatattaatgaatatattactgcacctgaagtgaacctttgtctaaccgtccaaacg
ttccaagaagccgttcatagccaaagctattcctacattcttgatagcgtttgttcatcg
gaagcaagggaagatatttacaaccaatggcgtgaggataagcatttgctgcaacgcaat
cgttttatcacagacttgtatgagaagtttattgatgagccttcgacaactaatctgtta
cgtacgattatggctaattacattcttgaaggcatctacttctacagtggattcagcttt
ttctatgcgttgggcagacaaggtaaaatgttgggaaccgtttctgaaatcaagtacatc
caaagagatgagcttacacatcttgctttattccaaggtattttccgtgagatccgtaca
gaaaacccagaattattcacaccggacttggttgaaagcctacgtgacatgatgcggaca
gccgttgaacatgaaattgcttggggattgtatattacccagaacaacattgccggatta
agtgatacagtaatcacacaatatattcaatacttgtctaatgatcgattgaagaagctt
aatcttgaaattctctatccggatattgtagagcatccaatgaaatgggtcgaaaccttc
agtaatatgaacggaatgaaaacagactttttcgaacaaaaggtaacaaattatagcaaa
tcatccggaatggattggggcgacatctaa

DBGET integrated database retrieval system