KEGG   Paenibacillus psychroresistens: EHS13_28720
Entry
EHS13_28720       CDS       T06328                                 

Definition
(GenBank) type IA DNA topoisomerase
  KO
K03169  DNA topoisomerase III [EC:5.6.2.1]
Organism
ppsc  Paenibacillus psychroresistens
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ppsc03032]
    EHS13_28720
Enzymes [BR:ppsc01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.1  DNA topoisomerase
     EHS13_28720
DNA replication proteins [BR:ppsc03032]
 Prokaryotic type
  DNA Topoisomerases
   EHS13_28720
SSDB
Motif
Pfam: Topoisom_bac Toprim Toprim_Crpt MutS_I
Other DBs
NCBI-ProteinID: QGQ98580
UniProt: A0A6B8RQD2
LinkDB
Position
6360156..6362390
AA seq 744 aa
MKTLIIAEKPDMGRNIAAAIEPKAVNNRTYLEGNDYIITWAIGHLISLAEPDKYDDKYKK
WNFNDLPIIPEHFKLLPNEKTKSQLTVISDLAKKCDHLVNACDAGREGQHIFSLIQRHLH
LQQPVKRLWISDLTPETIRHGFANLKDGAEYENLTKAAKARSEADWLVGMNGTRAFTSKH
NVLLSVGRVQTPVLALIYDRQIQIDAFASNKFYEVEGHFTQDTTSYKGNWQGDRITKPEQ
AEAIVAKVKGKIGAITSYEVKDTKEFPFKLFDLTLLQREANGKYAFSAKKTLDIAQVLYE
KHKVISYPRTNSNYVTEQNIPEMHRSLDALRGTPYETFVKDANKNFVNKNNKSICNPTKV
EDHHAILPTHKKANGLAPDEQKIYDLIVRRFLSHFYPAAEYKVHTVMTEVEKESFKTIVK
QLLDLGWKVIYADQAKETAKKPKGKDEEEELEEETSTSFSVDPNTEILCTDAIAKEKETQ
PPKHYNEGTLLKAMESAGKQVEDEELRDAMKDSGLGTPATRAATIERLKNVEYIEMQGKK
IQISPKGRMAIELIRSAGVELLTSPEMTGHWERRLNEISKGIASDATFMENVKKFTTLII
DKVRAQPRAAKEAFARPEPPAKPTKKPSKTAEDKAITKKSSTITVKKSTAPLSRESIASC
PREGCTGHIFMGNKGYGCSGYKEGCKFVIWKESFGKSISPAMVKMIIEKGRTNKLKLTDE
AGQAIEARIALINPVTGELKTEIM
NT seq 2235 nt   +upstreamnt  +downstreamnt
atgaaaacgttaatcatcgccgaaaaacccgatatgggacgcaatattgccgctgctatt
gagcctaaggcagtcaataatcgcacttatcttgaaggcaacgattatatcatcacctgg
gcgatcggacatttaatcagcttagctgaacccgataaatatgacgacaaatataaaaag
tggaattttaatgatctccccattattcctgaacatttcaagctgctgcccaatgaaaaa
accaaaagccagctcaccgttatttccgatttagccaaaaagtgcgaccatcttgttaat
gcatgtgatgccgggcgtgaggggcagcatattttctccttgattcaacgacatcttcat
ttacagcagcctgtaaaacgattatggatttccgatttgactccggaaactattcgtcat
ggcttcgcaaatcttaaggatggcgctgaatacgagaatttgaccaaagcagccaaagct
cgcagtgaagcggattggttagttggcatgaatggcacacgagcattcacatccaaacac
aatgtcttgctttccgttgggcgtgttcaaacaccggttttagcacttatttatgatcgc
cagattcaaattgatgctttcgcctctaataaattctatgaggttgaggggcattttact
caggacacaaccagctataaaggtaattggcaaggcgatcgtattactaaacctgagcaa
gccgaagctattgtcgccaaagttaagggtaaaataggagccatcacttcctacgaagta
aaggataccaaggaattcccttttaaattattcgatttaaccctgctgcagcgcgaagca
aatggcaaatacgctttttccgccaagaaaaccttggacattgcccaggtgctctatgaa
aaacacaaagtcatctcctatccgcgaacaaactcaaactatgtgacggaacagaacata
ccagagatgcatcgttctttggatgcgttacgcggcactccttacgagacttttgttaag
gatgctaataaaaattttgttaataaaaacaataaaagcatctgcaatcccaccaaggtt
gaggatcatcatgccattctgccgacccataagaaagccaatggattagcccctgatgaa
caaaaaatttatgatttgatcgtacgccgctttttatcgcatttttatccggccgctgag
tataaagtacatactgtgatgaccgaagtcgaaaaagaatcattcaaaaccatagtcaag
cagctgctggatctaggctggaaagtgatttatgccgatcaagccaaagaaacagctaag
aaacccaaaggaaaagatgaggaagaggagcttgaagaagagactagcacctcatttagt
gttgatcctaatacggagatcctctgtacagatgcaatcgctaaggaaaaggaaacccag
ccacccaagcattataatgagggcaccttgcttaaagctatggagagtgcaggtaaacag
gttgaagacgaggaattgcgtgatgccatgaaggattcaggcttaggcacaccggcaaca
cgggccgcaaccatagagcgcttaaaaaatgtggaatatatcgagatgcaaggtaagaaa
attcaaatctcgccaaaaggccgcatggcaatcgaactaattcgcagcgcaggtgttgag
ttattaacctcaccagaaatgaccggacattgggagcgtaggctcaacgaaatatccaaa
ggcattgcctctgatgccacgtttatggaaaacgttaagaagtttacgactttaattatc
gacaaagtgcgggcacagcctcgagcagctaaagaagcatttgcgcgtccagagcctcct
gcaaaaccaacaaaaaagccgtctaagacggcagaggataaggcaatcacgaaaaaatcg
tcaaccataacggtcaaaaaatcaaccgctccacttagtcgtgaaagtatcgccagctgc
ccgcgagaaggctgtaccggtcatattttcatggggaataaggggtacggctgcagcggt
tataaagaaggctgtaaattcgtgatctggaaagaaagctttggtaaatccatttctcct
gctatggtcaagatgattattgaaaaaggccgaaccaataaattgaagctgactgatgaa
gctggtcaagccattgaagcgagaattgctttaattaatccagtcacaggtgaattgaaa
acagaaattatgtaa

DBGET integrated database retrieval system