KEGG   Paenibacillus psychroresistens: EHS13_28820
Entry
EHS13_28820       CDS       T06328                                 

Gene name
mutY
Definition
(GenBank) A/G-specific adenine glycosylase
  KO
K03575  A/G-specific adenine glycosylase [EC:3.2.2.31]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    EHS13_28820 (mutY)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_28820 (mutY)
Enzymes [BR:ppsc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.31  adenine glycosylase
     EHS13_28820 (mutY)
DNA repair and recombination proteins [BR:ppsc03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     EHS13_28820 (mutY)
 Prokaryotic type
     EHS13_28820 (mutY)
SSDB
Motif
Pfam: NUDIX_4 HhH-GPD HHH EndIII_4Fe-2S
Other DBs
NCBI-ProteinID: QGQ98600
UniProt: A0A6B8RQF1
LinkDB
Position
complement(6382722..6383924)
AA seq 400 aa
MDNQLQKQYFSTELLLWYERSKRDLPWRRSKNPYYIWVSEIMLQQTRVDTVIPYFHRFIE
KFPTVAALAAAPESEVLKAWEGLGYYSRARNLQSAVREVHEQYNGIVPSDKAEISELKGV
GPYTAGAILSIAYNQPEPAVDGNVMRVLSRYFALEDDIAKPSTRIGIERLAQGLIPAGEA
GAFNQALMELGATVCTPRAPQCLTCPVQVHCAGRLAGIAEQLPVKTKAKPPRPERRAVAL
IVGSGAHGGQLLIRQRPQDGLLARMWELPHAELPPARSASAAEGVTPAAAPARGAQRRAA
RGGVPEESHDVVMAFLREHLAAADGIGIVPKAWFMNTEHVFSHILWDMFVYRCEAAAAAL
SSEAPNSLPPNYRWLNVNEMEEYPFPNVFLRIINEYKSLL
NT seq 1203 nt   +upstreamnt  +downstreamnt
ttggataatcagctgcaaaaacaatatttttcaacggagctgctgctctggtatgaacga
agtaaacgagatttgccttggcgaagaagtaaaaacccttattacatatgggtttctgag
ataatgctgcaacaaactagagtggatacggtgattccgtattttcatagatttatcgaa
aaattcccgaccgtcgctgcgcttgccgctgccccggagtctgaggttcttaaagcctgg
gaagggcttggttattattcccgtgctcgtaatctgcaatcggctgtacgtgaggtgcat
gaacaatataatgggattgtacctagtgataaagccgagatttctgagctgaagggtgtc
ggaccttatacggcaggtgctattcttagtattgcctataatcagcccgagcctgccgtg
gatggcaatgtgatgcgagtgctttcgcggtattttgccttggaggatgatattgccaag
ccaagtacgcggattggtattgagcgcttagcccaagggcttatcccagcgggcgaagca
ggcgcattcaaccaagcactaatggagcttggggcgacggtttgtacgccgcgcgcaccg
caatgtttgacttgcccggtgcaggtgcattgcgccggacgtttggccggcattgccgag
cagctgccggtcaagacgaaggcgaagccgccgcgtcccgaacgccgtgcggtggcgcta
attgtgggcagcggcgcccatggaggccagctgctcattcgccagcgcccgcaggacggg
ctgctggctcgcatgtgggagctcccacatgcggagctgcctccagcgcgcagcgctagc
gccgccgaaggcgtgacgcccgcggctgcgccagcacgcggagcacagcgccgtgcggcc
cgcggcggtgttcccgaggaaagccatgacgtggtcatggctttcctgcgggagcacctc
gcggcagccgacggcatcggcatcgtcccaaaagcatggttcatgaacacggagcacgtg
ttcagccacattctttgggacatgtttgtctaccgctgcgaggcagcagcggcagcactt
tcctcggaagcgccgaactcgcttccccctaactatcgttggctgaacgtcaacgaaatg
gaagaatacccttttcccaacgtattcttacgaattatcaacgaatacaagtctctattg
tag

DBGET integrated database retrieval system