KEGG   Paenibacillus psychroresistens: EHS13_31550
Entry
EHS13_31550       CDS       T06328                                 

Definition
(GenBank) ATP-dependent DNA helicase
  KO
K10844  DNA excision repair protein ERCC-2 [EC:3.6.4.12]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03022  Basal transcription factors
ppsc03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    EHS13_31550
  09124 Replication and repair
   03420 Nucleotide excision repair
    EHS13_31550
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ppsc03021]
    EHS13_31550
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_31550
Enzymes [BR:ppsc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     EHS13_31550
Transcription machinery [BR:ppsc03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     EHS13_31550
DNA repair and recombination proteins [BR:ppsc03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     EHS13_31550
SSDB
Motif
Pfam: Helicase_C_2 DEAD_2 DEAD ResIII PhoH
Other DBs
NCBI-ProteinID: QGQ99093
UniProt: A0A6B8RUG8
LinkDB
Position
complement(7039441..7041729)
AA seq 762 aa
MLEPIAIAVSVRSLVEYVFRSGSLDSGFRTMSTLAEGTKAHQKVQKQYGELDQKEVSLKA
EISHGDLLFVIDGRCDGLLIDENSGVTIDEIKSTARDVERITEDMHPVHWAQAKLYAYMY
AIENGNQRIKVQLTYVQVDTEHQKKFEQELRLAELVIFVAELVESYAPYARMVQHNKRLR
DESIRELAFPFPAFREGQRKLAGSVFKAIDEGRKLFAKAPTGIGKTVSTLYPAIKAIGAG
KAQHLFYLTARTITRTAAEEALALMKAQGLQMSSVTITAKDKICFQENVDCRKEACVYAD
GYYDRVNAAILDLMSNETLITRPLIEQYARKHTVCPFEFSLDMAYSADAVICDYNYVFDP
RISLKRLFGERKQQTVLLVDEAHNLVDRAREMFSAELVKKDFLELEREMKGVHPEVQLAA
KVLNKWFIQFRKESTEQSVVTKDKPTALIELVDAFIVQAEKVLAGGGTNEGSPRLLEVYF
SALGFQRIGKLYDGNYINYAEIARNEVQLKLFCLNPSDLLRQIGKSYRAHVYFSATLSPL
GYYMDILGAEQEDYSITLPTPFAKEQWEVSIVPISTKYIDREHTKAPLVNLLQAHVMEKL
ANYLIFFPSYEYMNSVYEAFMIDLDHDRVHTLLQRSEMPEEERESFLAAFSQSNDHALVG
FAVLGGIFSESIDLVGDRLQGVVVVGVGMPQISLERNLIKAYYDREQRSGFDYAYVYPGI
NKVLQAGGRLIRSEHDRGTLLLVDDRYKESRYRKLLPAEWLD
NT seq 2289 nt   +upstreamnt  +downstreamnt
atgcttgaaccaatcgccattgcagtatctgtaaggagccttgttgagtatgtatttagg
agtggaagcttggattctggctttcgcacaatgagtacgcttgcagaaggtacgaaggct
catcagaaggttcagaagcaatatggagagctggatcagaaagaagtaagcttaaaagcg
gagatttctcatggggatctcttatttgtcattgatggaagatgcgatgggctgctaatc
gatgagaacagtggagttacgattgatgagatcaagtctactgcgagggatgttgagcgg
ataacggaggacatgcatcccgttcactgggcgcaagccaaattgtatgcctatatgtat
gctatagaaaatggaaatcagcggataaaagttcaattaacctatgtacaagtggatacg
gaacaccagaagaaattcgagcaagaattaagattagctgagctcgttatttttgttgcg
gagcttgttgagagctatgcgccttatgccagaatggtgcaacacaataagcgtttgcgg
gatgaaagcatccgtgaattggcatttccctttcctgcttttcgagaaggacagaggaag
cttgcaggctcggttttcaaagccatagatgaggggcgaaagctattcgcgaaagcaccc
actgggattggtaaaactgtatcgacgctgtatcctgctattaaagcgatcggggctgga
aaagctcagcatcttttctatcttacagcgagaactattacgagaactgcagcggaggaa
gctttagcgcttatgaaagcccaaggactgcagatgagctcggtaaccataaccgccaag
gataaaatatgctttcaagagaacgtcgattgccgcaaggaggcatgtgtttatgccgat
ggttactatgaccgcgttaatgctgcgattctggatctgatgtccaacgaaaccttaatt
actcgccccttaattgaacaatatgctcgtaaacatacagtttgcccttttgaattttcc
ctggatatggcctattcagcggatgctgtgatctgtgattataattatgtatttgatccg
agaatctccttgaaacgtctatttggggagcgtaagcagcaaacggttttgttggtagat
gaagcacataatcttgtcgatcgggctagggaaatgttctctgcagagctagtgaagaag
gactttttagagctggagcgggaaatgaagggggttcatccagaagtccaactagcagct
aaggtgctcaataaatggtttatccaattcagaaaagagtctaccgagcaatccgttgtc
actaaggataaacctacagcacttattgagcttgttgatgctttcattgtccaagcagaa
aaagtgcttgctggaggcggaactaacgagggcagccccagactactggaagtgtatttc
tctgcgctaggcttccaaagaattggtaagctatatgatgggaattacattaactatgcg
gaaattgcgcgtaatgaggttcagcttaagctattctgcttgaatccttctgacttactc
cgacagattggtaaaagctacagagcacatgtttatttctcggcaacactttcacctcta
ggttattacatggacatattaggtgcggaacaagaggattattcgattacattgccaacc
ccattcgccaaagaacagtgggaggtttccattgtaccaatctctacgaagtatatagat
cgagagcatacaaaagctccgttagttaatttgcttcaggcacatgtgatggagaagctg
gctaattatctgatcttcttcccgtcttatgaatatatgaatagtgtttatgaagctttt
atgattgatctagatcatgatcgagttcacactttactgcaaagatcagagatgccagaa
gaggagagggagagctttctcgcggctttcagtcagagcaatgatcatgctttggttggg
tttgcggtcttaggcggtattttctcggagagcattgatttggttggagatcggctgcag
ggtgttgtcgttgttggtgttggcatgccgcagattagcttggagcgtaatcttattaaa
gcttattatgatagggaacaacgtagtggctttgattatgcctatgtgtaccctgggatc
aataaagtgctgcaagccggaggaagactcatccgttcggagcatgatcggggaacactt
ttgttagttgatgatcggtataaggagtcacgatatcgcaagctgcttcccgcggaatgg
ctggattaa

DBGET integrated database retrieval system